KEGG   Marinomonas sp. MWYL1: Mmwyl1_1662Help
Entry
Mmwyl1_1662       CDS       T00567                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmwyl1_1662
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmwyl1_1662
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_1662
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmwyl1_1662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1867891..1869147)
Genome map
AA seq 418 aa AA seqDB search
MQSENGFYGQYGGSYIPEILYSSQQQILHAFEEAKNDPEFLAELNKQWQQFSGRPTPLTF
CANLTEHFGGAQIYLKREDLNHSGAHKMNNVIGQGLLVKRMGKKRVIAETGAGQHGIATA
LVAARLGLECTIYMGAKDIERQYPNVFWMKQLGATVVPVTTGAQTLRDALDEALRDWSSS
HEESHYLIGTSCGCAPFPEMVAFFQSVIGNEVREQSVAQFGQFPDRLYACVGGGSNACGL
FLPFLDDKEVEMVGVEAGGKGLELGEHSIRLSHNLGQPGIAQGFATMFLQDNAGQLQETH
SIAAGLDYVGVSPIIAHLAETGRINMTYAMDDEVIAACTLLLKKEGIIPALESSHALAGA
FKDAPNLPKDSKIVINLSGRGDKDIFNVAKAVEDETFPQFLTDYLASYPTTQNKGDKA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcgagaacggtttctacgggcaatacggcggtagctatattcctgaaatcctt
tattcgagccaacagcaaattttacatgcgttcgaagaagccaaaaacgatccagaattt
ctcgctgagctgaataaacaatggcagcagttctctggccgcccaacgccgctgactttt
tgtgcgaatttgaccgaacactttggcggtgcgcaaatctatctaaagcgtgaagattta
aaccacagtggcgcgcacaagatgaacaacgtgattggccaaggtttattggtcaaacgc
atgggcaaaaaacgtgttatcgccgaaacaggcgcaggacaacatggtattgccaccgct
ttggttgcggcacgattaggactggagtgcacgatttacatgggcgcgaaagacattgaa
cgccaatatccaaatgtattctggatgaaacaacttggcgcaaccgtagtgcctgttacc
acaggcgcacaaacattacgtgatgcactagacgaagcattgcgcgattggtcttctagt
catgaagaaagccattatttgattggtacatcttgtggctgcgcccctttccctgaaatg
gtcgcattcttccaatccgttattggtaacgaagtacgcgagcaaagtgtggcacagttt
ggtcaatttccagaccgtttatacgcttgtgttggcggtggttcgaatgcttgtggtttg
ttcctacctttcctcgatgataaagaagtggaaatggtcggcgtcgaagctggcggtaaa
ggtttggagcttggcgaacactctattcgtttgtctcacaatcttggacagcctggtatc
gcccaaggctttgctaccatgttcttgcaagacaatgccggacagctacaagaaacccac
tcaatcgcagcaggcttagactatgttggcgtctctcctatcattgcccatttggccgaa
acaggtcgaattaacatgacctatgccatggacgatgaagtaattgccgcttgcactctt
ctactgaaaaaagagggtatcattccagcacttgaatcttctcatgcactagcgggcgct
tttaaagatgcaccgaacttacctaaagactcaaagatcgttatcaatctttctggtcga
ggtgacaaggatatctttaacgtggcaaaagcggtggaagacgaaaccttcccacaattt
ttaaccgattacctagcctcttacccaaccactcaaaacaaaggggataaagcatga

DBGET integrated database retrieval system