KEGG   Marinomonas sp. MWYL1: Mmwyl1_1771Help
Entry
Mmwyl1_1771       CDS       T00567                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmwyl1_1771
Enzymes [BR:mmw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Mmwyl1_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF2347 DUF3459
Motif
Other DBs
NCBI-ProteinID: ABR70697
JGI: Mmwyl11771
UniProt: A6VW68
Position
complement(2001709..2003466)
Genome map
AA seq 585 aa AA seqDB search
MENTPMSHLEQRLIAHLQVIYPSLDHKDLAQKCLATFHLDPSTESPRPHRNLWDQSDIML
ITYADTLRKAEEAPLETLHNFVKSTLSDCISAVHLLPFFPYSSDDGFSVMDYTTVNPSCG
RWADVVNLSQDFKVMGDLVINHCSSRSMWFENYKAGIEPGASFFFEADPNADLSAVVRPR
TSPLLREVQTKNGEKHVWCTFSHDQVDLNFENPAVLLEFLRIIRLYLEKGIRWFRLDAVA
FLWKIPGTSCINLPQTHEIIRLLRLMIEHYAPESVIITETNIPNQENLTYFGNANEAHLI
YNFSLPPLLINSLVTGNSSHLKQWLMSMTPAQQGTTYLNFIASHDGIGLRPTEGLLSEWE
LETLINTMKRFGGKISSRTTPQGEAKPYEINISLWNALSGSALHGPDKWQFARFLCAAGV
MMALEGVPAFYIHSLFGTENDLERVENTGQFRSINRHIWDMEDLDHVLNTPTHNQKVFQS
MTKLIQIRRSQPAFHPNATQYVLHMGENLFAFWRQSLDRRQSLFAVYNMTDQPQSFNLSE
LNLIATDTWTDLVSEQVYEDHLAKVTLMPYQFVWLANKKSKLKTS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacactccaatgtcgcatcttgagcaacgcctgattgctcatctgcaagtcatt
tacccaagtttggatcataaagatttggcgcaaaagtgtttagcgacttttcatttagat
ccgtcaaccgagtcacctcgcccccatagaaacctatgggatcaatctgacatcatgcta
attacctatgcagacacactgcgcaaagcggaagaagcaccgctcgaaacgctgcataat
tttgtgaaaagcaccttgtcagactgtatttctgccgttcacctactgccattttttcct
tatagctcggacgatggttttagcgtgatggattacacgaccgtcaatccatcctgtggt
cgctgggcagatgtggtaaacctgtcacaagattttaaagtgatgggggatttggttatc
aaccattgctcaagtcgaagcatgtggttcgaaaactacaaagcgggcatcgagcctggt
gccagcttctttttcgaagccgatccgaatgccgatttaagcgcggttgttcgccccaga
acctctcctttgttgcgtgaagtccaaaccaaaaacggcgaaaaacacgtttggtgtact
tttagccatgatcaagtggacttaaattttgaaaatccagctgtgctgctggagtttctt
cgcattattcgtttgtacctagaaaaaggcattcgctggttccgattagatgcggtcgct
tttctctggaagatccctggtacttcttgtatcaacttgccgcaaacccacgaaattatt
cgcttattacgcttaatgattgagcattacgcgccagagtctgtgatcattaccgaaacc
aacatccctaatcaggaaaacctgacctatttcgggaatgccaatgaagctcatctgatt
tataacttttccctgcctccgctgttgatcaatagtctggtgacaggtaacagcagccat
ttaaaacaatggttgatgagcatgacaccagctcaacaaggtacaacttacctgaacttt
attgcctctcatgacggtattggcttgcgacctacggaaggtcttctgtctgaatgggag
ctagaaacactcatcaataccatgaagcgttttggaggcaaaataagttcccgtactaca
ccgcaaggtgaagcgaaaccttatgaaataaatatcagcttatggaatgccttgtcaggc
tccgcattacatggcccagacaaatggcagtttgcccgcttcctatgtgccgcgggtgtg
atgatggctttagaaggcgtaccggctttttacattcacagtttgtttggcacagaaaac
gatttagagcgcgttgaaaatactgggcaattccgctcgatcaaccgccatatatgggac
atggaagatttagatcatgtcttaaatactccgactcataatcagaaagtcttccaaagc
atgactaagctgattcaaatacgtcgatcgcaacctgcatttcatcccaatgcgactcag
tacgtattgcacatgggtgaaaacttgtttgctttctggcgtcaaagccttgatagaaga
caaagcttatttgcggtttataacatgacagaccaaccgcaaagctttaatttgtcagaa
ttaaacctaatcgcaaccgatacctggacagatttagtatcagaacaagtctatgaagac
catttagccaaggtcactttaatgccctatcaatttgtttggcttgctaacaagaaaagt
aagctcaaaaccagttag

DBGET integrated database retrieval system