KEGG   Marinomonas sp. MWYL1: Mmwyl1_1771Help
Entry
Mmwyl1_1771       CDS       T00567                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmwyl1_1771
Enzymes [BR:mmw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Mmwyl1_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2001709..2003466)
Genome map
AA seq 585 aa AA seqDB search
MENTPMSHLEQRLIAHLQVIYPSLDHKDLAQKCLATFHLDPSTESPRPHRNLWDQSDIML
ITYADTLRKAEEAPLETLHNFVKSTLSDCISAVHLLPFFPYSSDDGFSVMDYTTVNPSCG
RWADVVNLSQDFKVMGDLVINHCSSRSMWFENYKAGIEPGASFFFEADPNADLSAVVRPR
TSPLLREVQTKNGEKHVWCTFSHDQVDLNFENPAVLLEFLRIIRLYLEKGIRWFRLDAVA
FLWKIPGTSCINLPQTHEIIRLLRLMIEHYAPESVIITETNIPNQENLTYFGNANEAHLI
YNFSLPPLLINSLVTGNSSHLKQWLMSMTPAQQGTTYLNFIASHDGIGLRPTEGLLSEWE
LETLINTMKRFGGKISSRTTPQGEAKPYEINISLWNALSGSALHGPDKWQFARFLCAAGV
MMALEGVPAFYIHSLFGTENDLERVENTGQFRSINRHIWDMEDLDHVLNTPTHNQKVFQS
MTKLIQIRRSQPAFHPNATQYVLHMGENLFAFWRQSLDRRQSLFAVYNMTDQPQSFNLSE
LNLIATDTWTDLVSEQVYEDHLAKVTLMPYQFVWLANKKSKLKTS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacactccaatgtcgcatcttgagcaacgcctgattgctcatctgcaagtcatt
tacccaagtttggatcataaagatttggcgcaaaagtgtttagcgacttttcatttagat
ccgtcaaccgagtcacctcgcccccatagaaacctatgggatcaatctgacatcatgcta
attacctatgcagacacactgcgcaaagcggaagaagcaccgctcgaaacgctgcataat
tttgtgaaaagcaccttgtcagactgtatttctgccgttcacctactgccattttttcct
tatagctcggacgatggttttagcgtgatggattacacgaccgtcaatccatcctgtggt
cgctgggcagatgtggtaaacctgtcacaagattttaaagtgatgggggatttggttatc
aaccattgctcaagtcgaagcatgtggttcgaaaactacaaagcgggcatcgagcctggt
gccagcttctttttcgaagccgatccgaatgccgatttaagcgcggttgttcgccccaga
acctctcctttgttgcgtgaagtccaaaccaaaaacggcgaaaaacacgtttggtgtact
tttagccatgatcaagtggacttaaattttgaaaatccagctgtgctgctggagtttctt
cgcattattcgtttgtacctagaaaaaggcattcgctggttccgattagatgcggtcgct
tttctctggaagatccctggtacttcttgtatcaacttgccgcaaacccacgaaattatt
cgcttattacgcttaatgattgagcattacgcgccagagtctgtgatcattaccgaaacc
aacatccctaatcaggaaaacctgacctatttcgggaatgccaatgaagctcatctgatt
tataacttttccctgcctccgctgttgatcaatagtctggtgacaggtaacagcagccat
ttaaaacaatggttgatgagcatgacaccagctcaacaaggtacaacttacctgaacttt
attgcctctcatgacggtattggcttgcgacctacggaaggtcttctgtctgaatgggag
ctagaaacactcatcaataccatgaagcgttttggaggcaaaataagttcccgtactaca
ccgcaaggtgaagcgaaaccttatgaaataaatatcagcttatggaatgccttgtcaggc
tccgcattacatggcccagacaaatggcagtttgcccgcttcctatgtgccgcgggtgtg
atgatggctttagaaggcgtaccggctttttacattcacagtttgtttggcacagaaaac
gatttagagcgcgttgaaaatactgggcaattccgctcgatcaaccgccatatatgggac
atggaagatttagatcatgtcttaaatactccgactcataatcagaaagtcttccaaagc
atgactaagctgattcaaatacgtcgatcgcaacctgcatttcatcccaatgcgactcag
tacgtattgcacatgggtgaaaacttgtttgctttctggcgtcaaagccttgatagaaga
caaagcttatttgcggtttataacatgacagaccaaccgcaaagctttaatttgtcagaa
ttaaacctaatcgcaaccgatacctggacagatttagtatcagaacaagtctatgaagac
catttagccaaggtcactttaatgccctatcaatttgtttggcttgctaacaagaaaagt
aagctcaaaaccagttag

DBGET integrated database retrieval system