KEGG   Marinomonas sp. MWYL1: Mmwyl1_2011Help
Entry
Mmwyl1_2011       CDS       T00567                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mmwyl1_2011
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mmwyl1_2011
   00600 Sphingolipid metabolism
    Mmwyl1_2011
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mmwyl1_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2276754..2278922
Genome map
AA seq 722 aa AA seqDB search
MKNGLDIGFYRQDSKDQSKTLVIACPKQGAPELLYFGDALPAQTDLGSIYLSQQAAIPQA
MMDKPVPMSLLPEAGRGWLQTPAVEASAEDRPTWAACWSLLDVEALESGFKIRLEDNVAQ
LSVSLSIGLLPSGVLRQQLTLTNQGQGDVMVQRLACTLPVAARFTERMGFYGRWCQEFQQ
ERSDWHATWLQENRNGRNSQANFPAVMVGEQGFGEQQGEVLGVHLAWSGNHRLKADYTAE
GHRYLQAEVLYLSGEIILAANASISTPEFLAAHSGTGLNAMSQQFHQEARARLQLAKPRP
VHLNTWEAFYFDHDMTKLKALAKAAADVGVERYILDDGWFRGRNNDKAALGDWFVDESKY
PDGLMPLISYVKEELGMEFGLWFEPEMVNPDSDLFRAHPDWALQLPQYKPALARNQLVLN
LAKSEAYQYIRERLFSLFTEYPIDYVKWDMNRDYSQPSGDIAPQAHAQVEALYRLLSELN
QAFPAMEIESCSSGGARVDFGILNFTKRFWASDCNDALERQTIQRGFSYFLPPEVMGSHI
GPDKSHTTSRIHDVAFRAGTAMLGHLGIEWNLLDANDEQKATISNWLSHYKRHRALLHEG
KNWRLPSADGRAQTQWALSQDRLQGLAVYSQLAMPKQAQTLPVRLPNLLPDQLYRVNVLE
HSPLPGHLMKALPEWWKKDLILNGASLSQVGLRLPIFDPESLVLLAIQAEPESENCDGEY
NE
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatggattggacatagggttttatcgacaagactcaaaagaccaaagcaagacc
ttggtgattgcttgcccaaaacaaggagcgccagaattactctactttggtgatgcgtta
ccagcgcagacggatttaggttcgatttatctgtcgcaacaagccgctattccgcaagcc
atgatggacaagcctgttcctatgtctttacttcctgaagcagggcgcggttggctgcaa
acgccagccgtggaggccagtgcagaagaccgcccaacttgggctgcctgttggagcttg
cttgatgtggaagcgctagaaagcggctttaagattcgtttggaagataacgtggctcaa
ttgtcggtgtcgctgtcgattggtttattgccatctggcgtcttacgccaacaactgacc
ttaactaaccaaggacagggcgatgtgatggtgcagcgcttggcttgtaccttgcctgtt
gctgcgcgttttactgagcgaatggggttttatggtcgttggtgccaagagtttcaacaa
gagcgcagtgactggcatgctacttggttgcaagaaaaccgcaacggccgtaactctcag
gcgaactttcccgcggtgatggttggtgagcaaggctttggggagcagcaaggggaagtg
cttggggtacatcttgcttggagcggaaaccacagactaaaagccgattacaccgcagaa
ggtcatcgttatttacaagcggaagtcttgtatttatctggtgaaattatcctcgccgcc
aatgcgtctatttcgacgcctgaattcttggcggcgcacagtggcactgggctaaatgcc
atgagtcagcagttccaccaagaagcgcgagctcgtttgcaattagctaagcctcgtcca
gtgcaccttaatacgtgggaagctttttatttcgatcatgatatgaccaaactaaaagcg
ctggctaaagccgccgctgacgttggggttgaacgttatattttggacgatggatggttt
cgcggtcgcaacaatgacaaagccgcgttaggggattggtttgttgatgaaagcaaatac
ccagatggattaatgcctttgatcagctatgtcaaagaggaactgggtatggagtttggt
ttgtggtttgaacctgaaatggttaacccagattccgatttattccgtgctcatcctgat
tgggctttacaacttccccaatacaaacccgctctcgcgcgtaatcaattggttctgaat
ttagcgaagtcggaagcctatcaatatatccgcgagcgtttattttcactcttcacagaa
tatcccatcgattatgtgaaatgggatatgaatcgagattattctcagccaagtggtgat
attgcaccgcaagctcatgctcaagttgaagctttgtatcgattgttgagcgagctcaat
caagcgtttcctgctatggaaattgaaagttgttcgtctggtggtgcgcgagtggatttt
ggtattttgaatttcactaaacgtttttgggcatctgactgtaatgatgcgttagagcgt
caaactatccaacgtggctttagctacttcttaccgcctgaagtgatgggttctcacatt
ggtcctgataagagccacactacaagccgtattcatgacgtagcattccgagcaggcaca
gccatgcttggtcatttaggtattgaatggaatttgttagacgccaatgacgagcaaaaa
gcgacgatttcgaactggttgtctcattacaagcgtcatagagcactgttgcatgaaggt
aagaattggcgtttgccaagcgctgacggtcgggcacaaacccagtgggcattgagtcaa
gaccgactacaaggtttggccgtttatagtcaattggctatgccaaagcaggcgcaaact
ctacctgttcgcctacctaacttattaccagatcagctctatcgagtgaacgttttggag
catagcccattgccaggccatttaatgaaagctttacctgaatggtggaaaaaagacctt
attttaaacggtgcgagtttgagtcaagttggactcagattacctatatttgaccctgaa
tctctagtattgctagcgattcaagccgagcctgaatcggaaaattgcgatggagaatat
aatgaatga

DBGET integrated database retrieval system