KEGG   Marinomonas sp. MWYL1: Mmwyl1_2042Help
Entry
Mmwyl1_2042       CDS       T00567                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00260  Glycine, serine and threonine metabolism
mmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01130  Biosynthesis of antibiotics
mmw01230  Biosynthesis of amino acids
Module
mmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmwyl1_2042
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_2042
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmwyl1_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABR70964
JGI: Mmwyl12042
UniProt: A6VWY5
Position
2313879..2315090
Genome map
AA seq 403 aa AA seqDB search
MDSKDINLDLPDSHGRFGPYGGIFVSETLMSALEDLAEMYERLSKDDAFQAAFDHDLAHY
VGRPSPLYFAERLTKKAGGAKIYLKREDLNHTGAHKINNTIGQALLAKHMGKPNIIAETG
AGQHGVASATVAARLGLKCKVFMGAEDIRRQSLNVYRMKLLGAEVISVESGTKTLKDALN
EAMRYWVGNVDDTFYIIGTAAGPHPYPKLVRDFQSVIGRETKAQCLAQEGRLPDALVACV
GGGSNAIGMFHPFIKDESVAMYGVEAGGDGIETGRHAAPLSAGRPGVLHGNRTYVMADDD
GQIIGTHSISAGLDYPGVGPEHAWLKDIGRANYVAINDDEAMTGFRDLTRLEGIMPALES
SHAVAYGMKLAATMDKDKIVVINLSGRGDKDILTVAELDGIEV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtggatagcaaagatattaatctagatttaccagactctcatggtcgttttggtccctat
ggcggcatatttgtttctgaaacattgatgtcggctttggaggatttggctgaaatgtat
gagcgtctatctaaagatgacgcttttcaggctgcttttgatcatgatttagcgcattac
gttggtcgtccatcgcctttatattttgctgagcggttaacgaaaaaagctggtggcgca
aagatatatcttaagcgtgaggatttaaaccacacaggtgctcacaagataaataataca
attggtcaggctttgcttgcgaaacatatgggcaaaccaaacattattgcagaaactggg
gctggtcagcatggtgtggcctctgcaactgttgctgctcgattgggtttgaagtgtaaa
gtatttatgggggcggaagatattcgtcgtcaatcacttaacgtatatcgtatgaagcta
ttaggtgcggaagtgatttccgttgagtctggcactaagacgttaaaagatgcgcttaat
gaagcaatgcgttattgggtggggaatgtggatgataccttttatattataggtactgct
gcaggccctcatccttatcctaaattggttcgagattttcaatctgtaattggtcgcgaa
actaaggctcagtgtttggctcaagaggggcgtttacctgatgctcttgttgcttgtgtt
ggtggcggatcaaatgccattggtatgtttcatccatttattaaagacgaaagtgttgcg
atgtatggtgttgaagcaggtggtgatggcattgaaacaggtcgccatgcggctccatta
agtgctgggcgtcctggtgttctgcatggcaaccgtacttatgtcatggctgatgatgat
ggtcaaattattggtactcattctatctctgcgggtttggattatcctggtgttggtcct
gaacatgcttggttaaaagatatcggacgcgctaactacgtggcgattaatgatgatgaa
gcgatgactggttttagagatttaactcgcttagaaggcataatgcctgcacttgagtca
agtcatgctgtggcttacggtatgaaattagcggcgaccatggataaagataagattgtt
gtaatcaacctttcggggcgtggtgataaagatattcttaccgttgcagaattggatggg
attgaagtatga

DBGET integrated database retrieval system