KEGG   Marinomonas sp. MWYL1: Mmwyl1_2043Help
Entry
Mmwyl1_2043       CDS       T00567                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00260  Glycine, serine and threonine metabolism
mmw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01130  Biosynthesis of antibiotics
mmw01230  Biosynthesis of amino acids
Module
mmw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmwyl1_2043
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_2043
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmwyl1_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABR70965
JGI: Mmwyl12043
UniProt: A6VWY6
Position
2315087..2315893
Genome map
AA seq 268 aa AA seqDB search
MSRIKQCFENLEKSGKKALIPYITAGDPNPDYTVTLMNALVDAGADVIEIGMPFSDPMAD
GPVIQLACERSLAAGTSVKKVLQIITEFRQSNKQTPIVLMGYLNPIEFFGYQAFSDAAKE
AGVDGILLVDLTPEEATDVVECFRENEIDLIYLLSPTTTPDRAKKICDLASGYVYYVSVK
GVTGSAELDVDSVKKHVDSLREITTLPIGVGFGIRDAKTAAAVSKCADGVIVGSVLVNAI
AENKDHQKEYIADALSAILLPMRNEMDA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcattaaacaatgttttgaaaatttagaaaagtctggtaaaaaggcgctcatt
ccgtatattaccgcgggtgatcctaatcctgattatacagtgaccttgatgaatgctttg
gttgatgctggtgctgatgttattgaaattggtatgcccttttcggatcccatggctgat
ggcccagtaattcagttagcctgtgagcgtagcttggcagctggtaccagtgttaaaaaa
gtactgcaaattattactgaatttagacaaagtaataaacaaacgcctattgttttgatg
ggctatttaaatccaattgagttttttggctatcaagctttttcagatgccgcaaaagaa
gcgggtgttgatggtattttattagtagatctgactcctgaagaggcgacagatgtagta
gaatgcttccgagagaacgagatagatcttatttatttgctgtcacctacgacaacacca
gatcgcgcaaagaaaatctgtgacttggcatcaggttatgtgtactacgtttctgtgaaa
ggtgtaactggttctgctgaactggatgttgatagtgttaagaagcatgtggattcattg
cgtgaaattaccaccttacctattggtgttggttttggtatacgcgatgcgaaaactgca
gcggcagtaagtaaatgtgctgatggcgtgattgttggtagtgtattagtgaatgctatc
gctgaaaataaagatcatcaaaaagaatatatagctgacgctttaagcgctattttattg
cctatgcgaaatgaaatggatgcttaa

DBGET integrated database retrieval system