KEGG   Marinomonas sp. MWYL1: Mmwyl1_2043Help
Entry
Mmwyl1_2043       CDS       T00567                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmwyl1_2043
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmwyl1_2043
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmwyl1_2043
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmwyl1_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2315087..2315893
Genome map
AA seq 268 aa AA seqDB search
MSRIKQCFENLEKSGKKALIPYITAGDPNPDYTVTLMNALVDAGADVIEIGMPFSDPMAD
GPVIQLACERSLAAGTSVKKVLQIITEFRQSNKQTPIVLMGYLNPIEFFGYQAFSDAAKE
AGVDGILLVDLTPEEATDVVECFRENEIDLIYLLSPTTTPDRAKKICDLASGYVYYVSVK
GVTGSAELDVDSVKKHVDSLREITTLPIGVGFGIRDAKTAAAVSKCADGVIVGSVLVNAI
AENKDHQKEYIADALSAILLPMRNEMDA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcattaaacaatgttttgaaaatttagaaaagtctggtaaaaaggcgctcatt
ccgtatattaccgcgggtgatcctaatcctgattatacagtgaccttgatgaatgctttg
gttgatgctggtgctgatgttattgaaattggtatgcccttttcggatcccatggctgat
ggcccagtaattcagttagcctgtgagcgtagcttggcagctggtaccagtgttaaaaaa
gtactgcaaattattactgaatttagacaaagtaataaacaaacgcctattgttttgatg
ggctatttaaatccaattgagttttttggctatcaagctttttcagatgccgcaaaagaa
gcgggtgttgatggtattttattagtagatctgactcctgaagaggcgacagatgtagta
gaatgcttccgagagaacgagatagatcttatttatttgctgtcacctacgacaacacca
gatcgcgcaaagaaaatctgtgacttggcatcaggttatgtgtactacgtttctgtgaaa
ggtgtaactggttctgctgaactggatgttgatagtgttaagaagcatgtggattcattg
cgtgaaattaccaccttacctattggtgttggttttggtatacgcgatgcgaaaactgca
gcggcagtaagtaaatgtgctgatggcgtgattgttggtagtgtattagtgaatgctatc
gctgaaaataaagatcatcaaaaagaatatatagctgacgctttaagcgctattttattg
cctatgcgaaatgaaatggatgcttaa

DBGET integrated database retrieval system