KEGG   Marinomonas sp. MWYL1: Mmwyl1_2189Help
Entry
Mmwyl1_2189       CDS       T00567                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmwyl1_2189
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mmwyl1_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2468020..2468622
Genome map
AA seq 200 aa AA seqDB search
MIGRIVGTLIEKTPPELMVDVNGIGYEVSASMTTIYDLPQIGGQVTLFTHLLVKEDSHTL
YGFIDKNERALFRVLIKVNGIGPKMALAILSSMSSEELITNVQESDVTALTRIPGVGKKT
AERLIIELRDKLGQAAKTDLFSAPAVLRQVQADPRQEAEAALISLGYKPQEAAKAIAGVP
VDAANSEDVIKAALKGMLRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgaattgtcggcactttgatagagaaaacccctccagagctgatggttgat
gttaatggtattggctatgaagttagtgcttctatgaccactatttatgatttacctcaa
atcggagggcaggtgacattatttactcacctattggttaaagaggattcgcatactctt
tatggctttatcgataaaaatgagcgcgctttatttcgggttttaattaaagtaaatggt
attggtccaaaaatggcgttggcaattttgtcgagcatgtcatctgaagaactgattacc
aatgttcaggagtctgatgtgacggcattaacgcgcattccaggagtaggcaagaaaacg
gctgagcgactcattattgagttaagagataagcttggtcaggcggcaaaaactgatttg
ttttcagctccagcggtgttgcgtcaggtgcaagctgaccctagacaggaagcagaagcg
gctctcatatctcttggatataaaccacaagaagcagcgaaagctattgcgggtgttcca
gtggatgccgctaatagtgaagatgtaattaaagctgctttaaaagggatgttaaggaaa
taa

DBGET integrated database retrieval system