KEGG   Marinomonas sp. MWYL1: Mmwyl1_2189Help
Entry
Mmwyl1_2189       CDS       T00567                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmwyl1_2189
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mmwyl1_2189
DNA repair and recombination proteins [BR:mmw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mmwyl1_2189
    RecFOR pathway proteins
     Mmwyl1_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 HHH_3 IMS_HHH Transposase_20 5_3_exonuc HHH_8 Cdd1 DNA_pol_lambd_f
Motif
Other DBs
NCBI-ProteinID: ABR71111
JGI: Mmwyl12189
UniProt: A6VXD2
Position
2468020..2468622
Genome map
AA seq 200 aa AA seqDB search
MIGRIVGTLIEKTPPELMVDVNGIGYEVSASMTTIYDLPQIGGQVTLFTHLLVKEDSHTL
YGFIDKNERALFRVLIKVNGIGPKMALAILSSMSSEELITNVQESDVTALTRIPGVGKKT
AERLIIELRDKLGQAAKTDLFSAPAVLRQVQADPRQEAEAALISLGYKPQEAAKAIAGVP
VDAANSEDVIKAALKGMLRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgaattgtcggcactttgatagagaaaacccctccagagctgatggttgat
gttaatggtattggctatgaagttagtgcttctatgaccactatttatgatttacctcaa
atcggagggcaggtgacattatttactcacctattggttaaagaggattcgcatactctt
tatggctttatcgataaaaatgagcgcgctttatttcgggttttaattaaagtaaatggt
attggtccaaaaatggcgttggcaattttgtcgagcatgtcatctgaagaactgattacc
aatgttcaggagtctgatgtgacggcattaacgcgcattccaggagtaggcaagaaaacg
gctgagcgactcattattgagttaagagataagcttggtcaggcggcaaaaactgatttg
ttttcagctccagcggtgttgcgtcaggtgcaagctgaccctagacaggaagcagaagcg
gctctcatatctcttggatataaaccacaagaagcagcgaaagctattgcgggtgttcca
gtggatgccgctaatagtgaagatgtaattaaagctgctttaaaagggatgttaaggaaa
taa

DBGET integrated database retrieval system