KEGG   Marinomonas sp. MWYL1: Mmwyl1_2207Help
Entry
Mmwyl1_2207       CDS       T00567                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mmwyl1_2207
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mmwyl1_2207
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mmwyl1_2207
Lipid biosynthesis proteins [BR:mmw01004]
 Fatty acid synthase
  Component type
   Mmwyl1_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2484422..2485051)
Genome map
AA seq 209 aa AA seqDB search
MFFKKQLRQMCTIITLLFISSFASASTLLVMGDSLSAAYNLRQQDGWVSLLENQLSQSHP
KLQVINASVSGETTQGGLSRFGDLLAIHKPDLVVLELGANDALRGYPLDQTTQNLEKMVE
QAQSSSAVVLLIGNQIPQNYGKRYTQMFFNLYKDIASKYNIAYLPFMLENVALNKDLMQN
DGLHPNKAGQPIVLQNIVPYLQPLIDNIK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcaaaaaacaattaaggcagatgtgtacaataatcacactgcttttcattagt
tcattcgcttcggcttccactttacttgttatgggcgatagcctcagtgcggcatataac
ttacgacaacaagatggctgggttagtttactagaaaatcaactttctcaatcacatccc
aaacttcaggttattaatgccagcgttagtggcgaaacaacacaaggtggtttgtcacgt
tttggcgatcttttagccattcataaaccagatttggtggttttagagcttggcgccaat
gatgcattacgtggttaccctttagatcagaccacacaaaatttggagaaaatggttgag
caagctcaaagtagtagcgctgttgtattactaataggcaatcagattccgcaaaattat
ggaaaacgctatacgcaaatgtttttcaatttgtacaaagatattgccagtaagtacaac
atcgcctacctaccctttatgcttgaaaatgtagcgttaaacaaagatctaatgcaaaac
gatggtttgcatcctaataaagcaggtcaaccaatagtacttcaaaatatagtgccatat
ttacaaccactaatagacaacatcaagtag

DBGET integrated database retrieval system