KEGG   Marinomonas sp. MWYL1: Mmwyl1_2461Help
Entry
Mmwyl1_2461       CDS       T00567                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Mmwyl1_2461
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mmwyl1_2461
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mmwyl1_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2771889..2772422
Genome map
AA seq 177 aa AA seqDB search
MSHPLNLSVKNIQSENVDLSTYQGKTVLIVNVASKCGLTPQYEGLEALYKKYHEQGLEIL
GFPANDFAGQEPGSNEEIQQFCSLTYDVTFPMFSKIAVTGEDKHPLYKGLIEAAPVTPNR
DAMVTMLAGHKIEATKAPEVVWNFEKFLVTKDGKVERFSPDVTPKDDALVAAIEADL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatccactcaatcttagcgttaaaaacatccagagcgaaaacgttgacctatcc
acttaccaaggcaaaacggttttgattgttaacgttgcgtcaaaatgtggtttaacaccg
cagtacgaaggccttgaagccttgtacaaaaaataccatgagcaaggcttagaaatcctt
ggtttccccgcgaatgattttgcaggtcaagagccaggcagcaatgaagaaattcaacag
ttttgcagccttacctacgacgttactttcccaatgttcagcaaaattgcggtcactggc
gaagacaagcatccgttatacaaaggcttgatcgaagcggctccggttacgccaaatcgc
gacgccatggttaccatgttggcaggtcataaaatcgaagctaccaaagcaccagaggtg
gtgtggaactttgaaaaattcctagtcaccaaagatggcaaagtagaacgtttctcacca
gatgtgacaccaaaagatgatgcacttgtagcagccattgaagctgatctataa

DBGET integrated database retrieval system