KEGG   Marinomonas sp. MWYL1: Mmwyl1_2717Help
Entry
Mmwyl1_2717       CDS       T00567                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00010  Glycolysis / Gluconeogenesis
mmw00052  Galactose metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_2717
   00052 Galactose metabolism
    Mmwyl1_2717
Enzymes [BR:mmw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Mmwyl1_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABR71630
JGI: Mmwyl12717
UniProt: A6VYV1
Position
3068404..3069387
Genome map
AA seq 327 aa AA seqDB search
MNLVPNLNQVQYVTLQNAQLKVSILTLGASIQSVYLNGYEHSLVLGSPKLTDYLQGAKYF
GAVVGRVANRTNKGHAVIGGKAYQLPPTLPEVHHLHGGPDGTGSKNWSIIKQTNDMVQLQ
TTLADGEMGYPGNMVVDVLYRLLDSTLEMEITATTDKLTICNFAGHSYVNLDGKGSILDH
QLSIQADHYLPVDAGLIPTGEVSPTAGSPFDFHQLRTIGREDYPDLDTNFCLSLASNRPL
QTVATLKAPITGLTLNYQTTEPGLQVYDGRHINLGAESNINQGALTAYAGLALEAQHWPD
AINQSHFPPILLAPEDTYRQVTRYEFV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctcgttccaaatttaaaccaagttcaatatgtcacgctacaaaacgctcaactc
aaagtgtctattttgacactgggcgctagcattcaatccgtttatctaaatggctatgag
cattctttagtattaggatcgccaaagctgaccgattatcttcaaggagcaaaatacttt
ggtgcggtagtcgggcgagtggcaaaccgaactaataaaggccatgccgtgattggcggt
aaagcatatcaattaccacctactctgcctgaagttcaccatttacacggcggcccagat
ggaacaggcagcaaaaactggtcaatcatcaaacaaactaacgacatggttcagctacaa
actacacttgctgacggtgagatgggctatccaggtaacatggttgtggatgtattgtat
cgtttgctcgatagcacattagaaatggaaatcaccgccaccacagacaaattaacgatt
tgcaattttgcggggcacagctacgtaaatcttgacggcaaaggctctattttagatcac
caactgagcatccaagccgatcattatttacctgttgacgctggattgattccaacaggc
gaagtctcacctacggctggcagcccgtttgattttcatcagcttcgcaccataggccgt
gaagattatcctgatctagacaccaacttctgcctttctcttgccagtaaccgcccacta
caaacagtcgctacactcaaagcgccaatcactggactcactctgaattaccaaacaaca
gaacctggcttacaggtttatgatggacgccacataaatctcggcgcagaatcaaatatc
aaccaaggcgcattaactgcctatgcaggtcttgctcttgaagctcaacattggccggat
gcgattaaccaatctcacttcccaccaatattacttgcaccagaagatacttaccgacaa
gtcacgcgctatgagttcgtgtaa

DBGET integrated database retrieval system