KEGG   Marinomonas sp. MWYL1: Mmwyl1_2734Help
Entry
Mmwyl1_2734       CDS       T00567                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00052  Galactose metabolism
mmw00511  Other glycan degradation
mmw00600  Sphingolipid metabolism
mmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mmwyl1_2734
  Lipid metabolism
   00600 Sphingolipid metabolism
    Mmwyl1_2734
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Mmwyl1_2734
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Mmwyl1_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 DUF4982 BetaGal_dom4_5 DUF2065
Motif
Other DBs
NCBI-ProteinID: ABR71647
JGI: Mmwyl12734
UniProt: A6VYW8
Position
complement(3093502..3096195)
Genome map
AA seq 897 aa AA seqDB search
MEITKIINRIVLAVAVFIFSIFSISASASSPREQLILDTGWKFLFSEGDKTDAFLQKDFD
DSVWQTISVPHTWNNVGYYQNDTTSHINTKNNINKQYGIGWYRLNFNVSSTNAKQQAWLE
FDAASRVAEVWLNGVYLGEHRGGFTRFRFDATQALYWDQNNVLVVKTDNTKPTADSSTAD
TLPIAGDFFVHGGLYRPVRLVFTDPVHFDMLDYGGPGVYATTDLTKAEKAQVTVSSRVKN
DAEQSKKIRVISQLVDAKGKTVAQAEQALTLEPKALATLKQNLDVANPTLWQGQENPYLY
TLRTEIRGSNNQVLDTLEQKYGLRNIVISPDKGFILNGKPLRLQGVAYHQDKEGLGWAVS
PEDVKQDVDLLVEMGANTLRLAHYPHGQSVHELADKYGLILWDEIPLVTSWTYGKDHKVA
NDGLLVNAELQLKEMIKQNFNHASVAFWGVANEVDFGAVVPAFLGATRGNTPDPIPVLKS
LADMVKQLDPSRASTLANCCEAREEVKDIDIPKTSPVADTVGLNRYYGWYYGDVDDFGPH
LDALHVQYPNLPISVSEYGAGGAVSLHTDNYLGAPVDSRGHHQPEEYMSYVHEENWRVIE
SKPYLFASWIWNAFDFATTVRTEGDSHDINTKGLITYDRAIKKDAYYFYQANWTTKPMVH
VTSSRYSQRHYQITDVKVYSNLDQTELWLNGKSLGVKADCSLKICVWPNVSLKVGDNTVV
AKGVGKQSSVQDETHWQLNKSQSNSYFIDAGALVAASTQEHSFGSDNFFYGGEAASFDKL
GGWGRPPVKPEINQTADRDLATTYRRGSFHYELPLSNGHYKVVLLTVAPSDDITSRFTVE
ANGHKIVEVNASKSESGENLIAEYHTAEVEVVEGLLNLKFVPVQGDAFVSAIEVTPI
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggaaattacaaaaataattaatcgaatcgtcttagctgttgcagtgtttatattttca
attttttcgataagcgcctcagcttcatcccctcgtgaacaattaatattggatacgggc
tggaaatttcttttttctgaaggggataaaacagatgcgtttttacaaaaagattttgat
gatagtgtatggcaaacaatcagtgttccacatacatggaacaacgtgggttattaccag
aatgacaccacgtctcacattaacactaaaaacaatatcaacaagcaatatggtattggt
tggtatcgattaaattttaatgtttcttctacgaatgcaaaacaacaagcatggttagaa
tttgatgcagcgagccgagtagctgaagtatggctaaatggagtgtaccttggtgagcac
cgaggaggttttactcgttttcgttttgatgcgactcaggctctgtattgggatcaaaac
aatgtgcttgttgtaaaaacggacaatacgaaacccaccgcagattcatcaactgccgat
actttgcccattgctggtgacttttttgtccacggtggtctgtatcgtcccgtaaggctg
gtattcaccgatccagtacatttcgacatgctggactatggtggacctggtgtgtatgcc
accaccgatttaactaaggcagaaaaagcgcaggtgacagtgagcagccgagtaaaaaat
gacgctgagcagtctaaaaagatacgagttatttctcaacttgtagatgccaagggtaaa
actgtggctcaggcagaacaagcgttaacacttgaacctaaagcattagcgacgttaaaa
cagaacttagatgtcgctaaccctactttatggcaaggacaagagaatccttatttatat
actctgcgaacagaaattcgtgggtcaaataatcaggttctcgatacactcgagcaaaaa
tatgggttgcgtaatattgtgatatctcccgacaaaggttttattctcaatggcaagcca
ctgcgtttacagggtgttgcttatcaccaagataaagaggggcttggttgggccgtgagt
ccagaggatgtcaaacaggatgtggatttgctggtggaaatgggggctaatacattgcgt
cttgctcattatcctcatggccagtctgtacatgagttagcagataaatacggtttgatt
ctttgggatgaaattcctttagtgacaagttggacgtatggcaaagatcataaagtggca
aatgacggattattggtcaatgcagagttgcagttaaaagaaatgatcaagcaaaatttt
aatcacgcatctgtcgctttttggggagtggcgaatgaagtagattttggtgcggtcgtt
cctgcgtttctgggggctactcgaggtaatactcctgatcctattcctgttttgaagtct
ctggcggacatggtaaaacagttggatcctagcagagcctcaacccttgctaattgctgt
gaagccagagaggaagtcaaagatatcgatattcccaaaacatcgccagtggctgatacg
gttgggcttaatcgttattatggctggtattatggggacgttgatgattttgggccgcac
ttagatgcattgcatgtgcaatatccaaatttaccaatatcggtaagtgaatatggcgca
ggtggcgcagtgtccttacacacagataattacttaggtgctccggtcgactctagagga
caccaccaacctgaagaatacatgtcttatgtgcatgaagagaattggcgtgtgatcgag
agtaaaccgtacctatttgctagctggatctggaatgcatttgattttgcgaccacggtg
cgaacagaaggggattcacatgatatcaacaccaaagggctgattacctatgatagagcg
ataaaaaaagacgcgtactacttttatcaagcgaactggacgactaagcctatggtgcat
gtcacctcaagtcgttactcgcagcgccactatcagattaccgacgttaaagtttattcc
aatcttgatcaaactgaattgtggttgaatggtaaatctttaggggttaaagccgattgc
tcattaaaaatttgcgtgtggccaaatgtcagtcttaaagtaggcgataacacggttgta
gctaaaggcgttggcaagcaatcttcagttcaggatgaaacgcattggcagttaaataaa
agccagagtaacagctactttattgatgctggcgcattagttgccgcatcaacacaagag
cattcttttggctcagataactttttttatggtggcgaagctgcatcgtttgataaatta
ggtggctggggacgtccgccagtgaagcccgagataaatcagactgcagatcgtgatttg
gctactacataccgtcgagggagctttcattatgagctgccattaagcaatggccactat
aaagtcgtcttactgacggttgctccttcggatgacataacgtcgcgatttactgtagaa
gcaaatggccacaaaattgttgaagtgaacgcgtcaaagtcagaatctggcgaaaaccta
atcgctgagtaccatactgcagaagttgaagtggtagaggggcttttaaatcttaaattt
gtaccagttcaaggtgatgcattcgtatctgctatcgaagttacgccaatctaa

DBGET integrated database retrieval system