KEGG   Marinomonas sp. MWYL1: Mmwyl1_3006Help
Entry
Mmwyl1_3006       CDS       T00567                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_3006
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_3006
   00620 Pyruvate metabolism
    Mmwyl1_3006
   00640 Propanoate metabolism
    Mmwyl1_3006
  Energy metabolism
   00680 Methane metabolism
    Mmwyl1_3006
Enzymes [BR:mmw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mmwyl1_3006
Lipid biosynthesis proteins [BR:mmw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mmwyl1_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3393761..3395719)
Genome map
AA seq 652 aa AA seqDB search
MKSLYSATSNEAAKNANVSQAEFEKRYQESIENPDEFWGREGKRIDWFKPYTKVKNTSFK
RGEVSIKWFEDGELNVAYNCIDRHLAKSANKVAYYCEGDKESDEKVAITYQTLHDEVGRL
ANLLKRQGVKKGDRVAIYMPMIPQAVYAMLACARIGAIHSVIFGGFSAHAIADRLNDCEV
KLVITADEGRRAGNTIPLKHNVDMALDNNACPTVENVIVYRYTEKDVPWFEGRDLDWAVE
VENESTECPAERMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYASLTHELVFDLKPDDV
YWCAADVGWITGHSYMVYGPLANGTTSILFEGVPTYPDSGRIGRVVDKFDVTILYTAPTA
IRALMAKGDEATRSSKRDSLRVLGSVGEPINPEAWSWYYSEIGNSSCPIVDTWWQTETGG
MMMTPRIVQGDVKPGSCTGPLYGVQPALVDAQGVLQEEQGVLVEGGLVITDSWPGQARTV
YGDHERFEQTYFSTFDGMYFTGDGASRDADGHYWITGRMDDVLNVSGHRLGTAEIESALV
AHPSVAEAAIVGFPHDIKGQGIYVYVSAIAGVIPDEELTKSLKLFVRQEIGPIATPDLIQ
WTSKGLPKTRSGKIMRRILRKIAANEHDQLGDTSTLADPSVVDDLIENRLNV
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcattatatagcgcaacctcaaatgaggcggcaaaaaatgccaatgtgagtcaa
gcagaatttgaaaaacgctatcaagaatcgattgaaaatccagatgagttttgggggcga
gaagggaagcgtatagactggtttaagccttatacaaaagttaaaaacacctcttttaaa
cgaggcgaagttagcattaagtggtttgaagatggtgagttaaatgtggcttataactgc
attgatcgtcacttagctaaatctgcaaataaagtcgcttactactgtgaaggtgataaa
gaaagcgatgaaaaagtcgcaattacctaccaaacattacacgatgaggttggacgttta
gccaacctgttaaaacgtcagggcgttaaaaaaggcgaccgcgttgctatttatatgcca
atgattccgcaagccgtctacgctatgttggcgtgtgctcgaattggtgcgattcactct
gttattttcggtggtttttcagcgcatgctatcgccgatcgtttaaacgattgtgaagta
aagctggttattaccgcagacgaaggtcgtcgtgctggtaacactattcctcttaaacat
aatgttgatatggcgttggacaacaatgcttgtccaactgttgaaaatgttattgtctac
cgttacacagaaaaagacgtgccttggtttgaaggccgtgatttagactgggcggttgaa
gtagaaaacgaaagtactgaatgtccagcagaacgtatgaacgcggaagaccctttgttt
attctttatacatctggttcaaccggtaagccaaaaggtgtggtgcacacaacaggcgga
tatttggtgtatgcctcgttaactcatgaattggtatttgatcttaagccagatgatgtt
tattggtgtgccgctgatgtgggctggatcacaggccatagttatatggtttacgggcca
cttgctaatggcacaacgagcatcttatttgaaggggtgccaacgtatcctgattcaggt
cgaattggtcgcgtggttgataaatttgacgtgaccattctgtacacagcaccaacggct
attcgagctttgatggcgaaaggcgatgaagcgacgcgttcaagtaagcgagattcttta
cgagtattaggtagtgtgggtgagcctatcaacccagaagcttggtcttggtattacagc
gaaattggtaattcctcttgtcctatcgttgatacttggtggcaaactgaaactggtggc
atgatgatgacgccacgtattgttcaaggtgatgtaaaacctggttcatgtactggtcct
ttatatggtgtgcaacctgctttggtagacgcgcaaggcgtcttgcaagaagagcaaggc
gtgttagtggaaggtggtttggttattacggattcttggccaggccaggcgcgaactgtt
tatggcgatcatgagcgtttcgagcaaacttacttcagtactttcgacggtatgtacttc
actggtgacggcgcatctcgcgatgcagatggccattattggattactggccgtatggat
gatgtattgaacgtttcagggcatcgtcttggaacagctgaaatagaaagcgcattagtg
gctcatccttctgtcgctgaagctgctatcgtgggattccctcatgatattaaaggacaa
ggcatttatgtttatgtcagtgcgattgctggtgtgattccagatgaagaattgactaag
tcactaaagctgtttgttcgtcaagaaattggtcctattgcaacgccagaccttattcaa
tggacaagtaaaggtttgccgaaaacgcgatcaggtaaaattatgcgtcgaattttaagg
aagattgccgcaaacgaacatgatcaattgggtgatacaagtacattagctgatccaagt
gtggttgatgatttaatcgaaaaccgtttaaatgtgtga

DBGET integrated database retrieval system