KEGG   Marinomonas sp. MWYL1: Mmwyl1_3060Help
Entry
Mmwyl1_3060       CDS       T00567                                 

Definition
formaldehyde dehydrogenase glutathione-independent
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_3060
  Energy metabolism
   00680 Methane metabolism
    Mmwyl1_3060
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mmwyl1_3060
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Mmwyl1_3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3456390..3457583
Genome map
AA seq 397 aa AA seqDB search
MSNHANRGVIYQGNGTVKVEAIPFPELSIGKRRCDHGVILKVVTTNICGSDQHMVRGRTT
AEKGLVLGHEITGEVIECGRDVEFIKVGDLVSVPFNIACGRCRNCKEGKTGICLNVNPAR
PGAAYGYVDMGGWVGGQADYVMVPYADFNLLKFPDRDQALEKIQGLTLLSDILPTGYHGC
VTAGVGPGSTVYIAGAGPVGLAAAASAHLLGAACVIVGDMVEDRLNQARSFGCETIDLTQ
EGDIQDKIEAILGDREVDAFVDCVGFEAHACGCNHHQESPAVVLNSAMQMTRAGGQIGIP
GLYVTEDPGAVDAAAKQGSLSMRFGLGWAKSHSLHTGQCPVMKYHRQLMQAILFDKIDIA
KAVNVQMISLDQAPQGYADFDGGAAKKFVIDPHKMVS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcatgcaaaccgcggtgttatttatcaaggtaacggcactgtcaaagtagaa
gcaatcccctttccagaactttctattggcaagcgccggtgtgatcacggcgttattcta
aaagttgttacaactaacatttgtggtagtgaccaacacatggttcgtggtcgaacaact
gcagaaaaaggcttggttcttggccatgaaatcactggcgaagttatcgaatgtggtcgc
gatgtcgaatttatcaaagtcggcgacttagtttctgttcctttcaacattgcttgtggc
cgctgccgcaactgtaaagaaggtaaaacaggtatttgtttgaacgtaaacccagctcgc
ccaggtgcggcttatggctacgtagatatgggtggctgggttggcggacaagctgactac
gttatggtgccatacgcagactttaacctactaaaattccctgatagagaccaggctctg
gaaaaaatccaaggcctaacattgctttctgacattcttcctactggttaccatggctgc
gtcaccgctggcgtgggtccaggttctaccgtttatatcgcgggcgctggccctgttggt
ctagccgcagcggcatccgctcacctacttggcgcagcttgtgtcatcgtcggtgacatg
gtggaagatcgtctaaaccaagcacgttctttcggctgtgaaacaatcgacctaactcaa
gaaggcgatatccaagacaaaattgaagcaattcttggtgaccgcgaagtcgatgctttt
gtcgattgcgtgggctttgaagcacatgcttgtggttgcaaccaccatcaagaatcccct
gctgttgttctaaactctgctatgcagatgacacgtgctggtggacaaattggtatccca
ggtctgtacgtaacagaagatccaggtgcggttgacgctgctgctaagcaaggtagcttg
agcatgcgctttggtctaggttgggcgaaatctcactcattgcataccggacaatgtcct
gttatgaaataccatcgccaactaatgcaagccatcttgtttgataagatcgacattgca
aaagcggttaacgtacaaatgatttcacttgatcaagcaccacaaggttatgctgacttt
gatggcggcgcagcgaagaaattcgttatcgatccacacaaaatggtaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system