KEGG   Marinomonas sp. MWYL1: Mmwyl1_3101Help
Entry
Mmwyl1_3101       CDS       T00567                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00071  Fatty acid degradation
mmw00280  Valine, leucine and isoleucine degradation
mmw00281  Geraniol degradation
mmw00310  Lysine degradation
mmw00360  Phenylalanine metabolism
mmw00362  Benzoate degradation
mmw00380  Tryptophan metabolism
mmw00410  beta-Alanine metabolism
mmw00627  Aminobenzoate degradation
mmw00640  Propanoate metabolism
mmw00650  Butanoate metabolism
mmw00903  Limonene and pinene degradation
mmw00930  Caprolactam degradation
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmwyl1_3101
   00650 Butanoate metabolism
    Mmwyl1_3101
  Lipid metabolism
   00071 Fatty acid degradation
    Mmwyl1_3101
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmwyl1_3101
   00310 Lysine degradation
    Mmwyl1_3101
   00360 Phenylalanine metabolism
    Mmwyl1_3101
   00380 Tryptophan metabolism
    Mmwyl1_3101
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmwyl1_3101
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mmwyl1_3101
   00281 Geraniol degradation
    Mmwyl1_3101
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmwyl1_3101
   00627 Aminobenzoate degradation
    Mmwyl1_3101
   00930 Caprolactam degradation
    Mmwyl1_3101
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mmwyl1_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABR72011
JGI: Mmwyl13101
UniProt: A6VZY2
Position
complement(3514288..3515115)
Genome map
AA seq 275 aa AA seqDB search
MERTNNNKIECLNQMTIKNYQSLVVHQVEDGVQLVQLNRPEALNALTTELLAELCDVMDG
VEASSDIRVLVLTGSSKAFAAGADINEMAERDLVGMLNDPRQQYWQRITRFTKPVIAAIN
GYCLGGGCELAMHADILIAGRDAQFGQPEINLGIMPGAGGTQRLLRAVGKSLTMQMVLTG
QPINAQQAKDAGLISEITQPELTVTRALALAKVIASKGSLAVRLAKESILKGMDTDLATG
LRFERHAFTVLAGTEDRKEGILAFKEKRQPKFSGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgaactaataacaataagatcgagtgtttgaatcaaatgacaattaaaaattac
caatcattggtagtgcatcaggttgaagatggggttcagttggtgcagttgaaccgtccc
gaagcactgaatgctctaaccacagagttattggcggaattatgcgatgtcatggatggc
gttgaagcatcaagtgatattcgagtcttggtgctgactggcagttcgaaggcttttgcc
gctggagcggatattaatgagatggcagagcgcgatcttgttggtatgttgaatgatcct
cgtcagcaatattggcagcgcataacacgttttactaagcctgttattgcggccattaat
ggatattgtttgggtggcggctgcgagttagccatgcatgcagatattcttattgcaggt
cgcgatgcccaatttggtcaacccgaaattaatctaggcatcatgcctggcgctggtgga
acccagcgtttattacgtgctgttggtaaatctctcaccatgcaaatggtgcttaccggt
caacctatcaatgcccagcaggcaaaagatgctggtctcatcagtgaaataacccaacct
gaactgacagttactagagctttggctttggcgaaagtcattgcgagcaaaggcagtctg
gctgtgcgtttagcaaaagaatccattctaaaaggcatggatactgacttagcaacaggc
ctgcgttttgaacgccatgcttttactgtgctggctggaactgaagatagaaaagaaggg
attttggcgtttaaagaaaaacggcaaccaaaattttctggtcggtaa

DBGET integrated database retrieval system