KEGG   Marinomonas sp. MWYL1: Mmwyl1_3113Help
Entry
Mmwyl1_3113       CDS       T00567                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
mmw  Marinomonas sp. MWYL1
Brite
Enzymes [BR:mmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Mmwyl1_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3527957..3528739)
Genome map
AA seq 260 aa AA seqDB search
MTDKKQFWVGTSWKMNKTLAEAQAFSVALKTDDANADAHIQRFVIPAFTCVREVKEILRD
TSVKVGAQNMHWAEHGAWTGEVSPLMLNDCHIDIVELGHSERREYFGETNETVGRKVESA
IRHGLIPLICVGETLADKESGQAAHVLAKEVRGALQFLSDDQKDAPILFAYEPVWAIGER
GIPASAEYADARQAEILDVAKKVLGRKVPCLYGGSVNPNNCEELIACEHVDGLFIGRSAW
SVSGYIDILNKCAAAVQAQI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaaagcaattttgggttggtacaagttggaaaatgaataagacactggca
gaggcgcaagcgttttcagtcgctttaaagactgatgatgctaatgcagatgcccatatt
cagcgatttgttattcctgcatttacatgtgtacgtgaagtaaaagaaatacttcgtgat
acatccgtaaaagtaggggctcaaaatatgcattgggcagaacatggagcttggacagga
gaagtgtctcctctcatgttgaatgactgtcacattgatattgttgaactgggtcactcc
gaacgacgagagtactttggtgaaacgaatgagacggttggtcgtaaggtcgagtctgct
attcgtcatggtttaattccccttatctgtgttggcgaaacattggcagataaagaaagc
ggacaggcagctcatgtcttagcaaaagaagtgcgtggtgcgttgcaatttctgagcgat
gaccaaaaagatgcgcctattttgtttgcttatgagcctgtttgggcaataggtgagcga
gggattcctgcttctgcagagtatgccgacgcaagacaagctgaaattctggatgttgcc
aaaaaagtattgggacgcaaagttccttgtttatatggcggttcggtgaaccctaataac
tgtgaagaacttatagcctgcgaacacgttgatggtttatttattggtcgctccgcttgg
agtgttagtggatatatcgatattttaaataaatgtgccgcagccgttcaagcgcaaata
taa

DBGET integrated database retrieval system