KEGG   Marinomonas sp. MWYL1: Mmwyl1_3113Help
Entry
Mmwyl1_3113       CDS       T00567                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_3113 (tpiA)
   01230 Biosynthesis of amino acids
    Mmwyl1_3113 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_3113 (tpiA)
   00051 Fructose and mannose metabolism
    Mmwyl1_3113 (tpiA)
   00562 Inositol phosphate metabolism
    Mmwyl1_3113 (tpiA)
Enzymes [BR:mmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmwyl1_3113 (tpiA)
Exosome [BR:mmw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmwyl1_3113 (tpiA)
  Exosomal proteins of bladder cancer cells
   Mmwyl1_3113 (tpiA)
  Exosomal proteins of melanoma cells
   Mmwyl1_3113 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3527957..3528739)
Genome map
AA seq 260 aa AA seqDB search
MTDKKQFWVGTSWKMNKTLAEAQAFSVALKTDDANADAHIQRFVIPAFTCVREVKEILRD
TSVKVGAQNMHWAEHGAWTGEVSPLMLNDCHIDIVELGHSERREYFGETNETVGRKVESA
IRHGLIPLICVGETLADKESGQAAHVLAKEVRGALQFLSDDQKDAPILFAYEPVWAIGER
GIPASAEYADARQAEILDVAKKVLGRKVPCLYGGSVNPNNCEELIACEHVDGLFIGRSAW
SVSGYIDILNKCAAAVQAQI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaaagcaattttgggttggtacaagttggaaaatgaataagacactggca
gaggcgcaagcgttttcagtcgctttaaagactgatgatgctaatgcagatgcccatatt
cagcgatttgttattcctgcatttacatgtgtacgtgaagtaaaagaaatacttcgtgat
acatccgtaaaagtaggggctcaaaatatgcattgggcagaacatggagcttggacagga
gaagtgtctcctctcatgttgaatgactgtcacattgatattgttgaactgggtcactcc
gaacgacgagagtactttggtgaaacgaatgagacggttggtcgtaaggtcgagtctgct
attcgtcatggtttaattccccttatctgtgttggcgaaacattggcagataaagaaagc
ggacaggcagctcatgtcttagcaaaagaagtgcgtggtgcgttgcaatttctgagcgat
gaccaaaaagatgcgcctattttgtttgcttatgagcctgtttgggcaataggtgagcga
gggattcctgcttctgcagagtatgccgacgcaagacaagctgaaattctggatgttgcc
aaaaaagtattgggacgcaaagttccttgtttatatggcggttcggtgaaccctaataac
tgtgaagaacttatagcctgcgaacacgttgatggtttatttattggtcgctccgcttgg
agtgttagtggatatatcgatattttaaataaatgtgccgcagccgttcaagcgcaaata
taa

DBGET integrated database retrieval system