KEGG   Marinomonas sp. MWYL1: Mmwyl1_3122Help
Entry
Mmwyl1_3122       CDS       T00567                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmwyl1_3122
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmwyl1_3122
  Amino acid metabolism
   00310 Lysine degradation
    Mmwyl1_3122
Enzymes [BR:mmw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmwyl1_3122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3537426..3538670)
Genome map
AA seq 414 aa AA seqDB search
MNESMTITLPVGALEGTAAVFSTWLVEEGDHVRKGDPILELETDKVSMEVCAENDGFIGK
ILATSGDNVDEKTILGYLNCGEQSEVDKASVDKSSSPVANDASKNIAVAKCGVADDGSKR
HLIGPAVRKLLRKHNLNLSSIDGSGKGGRVTRDDILAFIDTQASKEQSNLNVSTSAEKSH
GLKSKLVPHTAMRKKIANHMVDSLLHTSPHVTSVFEMDMGRIIEHRKMCKMGFEEAGVKL
TFTAYFLAASAKAMQKVPVVNSRFHDDCLEIFEDINIGVGTALGDDGLIVPVVKQVQEKN
LFEIASALQQQTDKARQGKLAAADMRDGTFTISNHGVSGSLFATPIIINQPQVAILGIGK
LEKRAVVEEVDGEDTIVIRPKCYVSLSIDHRALDAYQTNLFLSHFVEVIENWGI
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatcaatgactattacgcttccagtgggggctttagagggaaccgcggcggta
ttttctacttggctggtagaagagggtgatcatgttcgaaaaggcgatcccatattagag
ctggaaacagacaaggtatcgatggaagtgtgtgctgaaaatgatggcttcattggaaaa
atcttggcgacatcgggtgataatgttgatgaaaagaccatccttggctacttaaattgt
ggtgaacaatcagaggtagataaagcttcggtagataaatcatcatctcctgttgctaat
gacgcttcgaaaaatatagcagttgctaaatgcggcgtggctgacgatggctcaaaacgc
catttaattggacctgcggtcagaaagttattgagaaaacataacctgaacttgtcctct
attgatggctcaggtaaaggtggacgtgttacgcgagatgatattttagcctttattgat
acccaagctagcaaggagcaaagcaacttaaatgtttctacttcagctgaaaaatcgcat
ggtttaaaaagtaagctggttcctcatactgccatgcgcaagaaaatcgccaatcatatg
gttgatagtttgcttcatacatcgccacacgtaacgagtgtttttgagatggatatggga
cgaatcatagagcacagaaaaatgtgcaaaatgggctttgaagaagctggtgtaaaactg
acttttaccgcttatttcttggcggccagcgcgaaggcgatgcaaaaagttcctgttgtt
aattcgcgttttcatgatgattgcttggaaatatttgaagacattaacataggtgtcggc
accgcgttaggcgatgatggattgattgtcccagtcgttaaacaggttcaagagaagaac
ttgtttgaaatcgcctcagccctacagcaacaaacagacaaagccagacaaggtaaactg
gctgccgcagacatgagagatggtacatttaccatctcaaatcatggcgtgagcggcagt
ttatttgctacgcccattatcattaatcagccacaagtggctattttggggattggcaag
cttgaaaaaagagccgtggtggaagaggtggatggtgaagacacaattgtcatccgacca
aaatgctatgtgtccctaagtatcgatcatcgagccttggatgcatatcagactaactta
tttctgagtcattttgtcgaggtgatagaaaactggggaatataa

DBGET integrated database retrieval system