KEGG   Marinomonas sp. MWYL1: Mmwyl1_3531Help
Entry
Mmwyl1_3531       CDS       T00567                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmwyl1_3531
   00052 Galactose metabolism
    Mmwyl1_3531
   00500 Starch and sucrose metabolism
    Mmwyl1_3531
   00520 Amino sugar and nucleotide sugar metabolism
    Mmwyl1_3531
Enzymes [BR:mmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmwyl1_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3981254..3982090
Genome map
AA seq 278 aa AA seqDB search
MIRKCLFPVAGYGTRFLPATKSMPKEMLPIVNKPLVQYGVEEAVKAGLDNVTFVTGRGKR
AIADHFDISYELEHQIAGTNKEKYLNEIRYLIDNVNFSFTRQNNMLGLGHAILTGEPLIG
DEAFGVVLADDLCFGEDDGVMAQMVKLYNQFRCTIVAIEEVPENEVHKYGVIQGESMMEG
LYRVTDMVEKPSKEDAPSNLAIIGRYILTPDIFDKIRNTPAGRNGEVQITDAILQQAKEG
CVLAYKFKGKRFDCGSVDGFVEATNYCYKNIYQDPTEV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcaaatgtctattccctgttgctggttatggcacacgttttttgcctgccact
aaatccatgccaaaagaaatgcttccgattgtaaacaagcctttggttcaatatggcgta
gaagaagcggtcaaagcgggtttggacaatgttacttttgtaacgggtcgtggtaaacgt
gctattgctgaccatttcgatatcagctacgagcttgagcatcaaattgcaggtaccaac
aaagaaaaatacctaaatgagattcgctatctaatcgacaacgttaacttctcttttact
cgtcaaaacaacatgttaggtctaggccatgccattttgactggcgagccacttattggt
gatgaagctttcggtgtggtactagcagacgacctttgcttcggtgaagacgatggcgta
atggctcaaatggtcaagctttacaaccagttccgttgcaccattgttgctatcgaagaa
gtgccagaaaacgaagtacataagtacggtgtgatccaaggtgaatccatgatggaaggc
ctgtaccgtgttaccgacatggtggaaaaaccatccaaagaagacgcgccatcgaatctt
gctatcattggccgttacattctaacgccagatatttttgacaagatccgcaacacacct
gctggccgtaacggcgaagttcaaatcaccgacgccattttgcaacaagccaaagaaggc
tgtgtattggcttataaatttaaaggcaaacgttttgactgcggtagtgttgatggcttc
gttgaagcaaccaactactgctacaaaaacatttaccaagatcctactgaagtgtaa

DBGET integrated database retrieval system