KEGG   Marinomonas sp. MWYL1: Mmwyl1_3592Help
Entry
Mmwyl1_3592       CDS       T00567                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00860  Porphyrin and chlorophyll metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
Module
mmw_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmwyl1_3592
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mmwyl1_3592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABR72494
JGI: Mmwyl13592
UniProt: A6W1B5
Position
4054504..4055256
Genome map
AA seq 250 aa AA seqDB search
MQDCRILITRPEPENSLSRERVRAYGWVAVPLPMLEIKPVEDVNKKATIRAQIFDIDTFD
YVIFVSKNAARLACDWLDECWPMIPTNVHWIGIGQGTTQTLLNEGIPAISNPGHTTETLL
EWLKPAKMKDQKVLIIRGEGGRPELANKLEERGAKVSYLSLYDRKKPIYYAQTFFMLPDI
NLIWITSGESLRNLSEYVSLHKPEWKTLPILTPSIRVNQQAKEMGWINASCANGADDNSL
IKATEFHTGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagactgtcgtatcctaataacccgcccggaacctgaaaattcgcttagccgtgag
cgcgttcgcgcttacggctgggtagctgtaccacttccaatgctggaaattaagcctgta
gaagatgtaaacaaaaaagctactattcgggcacaaatttttgatatcgatacgtttgat
tacgttatatttgttagtaaaaatgccgctcgtctcgcgtgcgactggctagatgaatgc
tggccaatgatacccaccaatgttcattggatcggcataggccaaggcacaacacaaaca
ctattaaatgaaggcattccagccatatcgaatcctggacatactactgaaaccttactc
gaatggttaaagcctgccaaaatgaaagatcagaaagtattgattattcgtggcgaaggt
ggacgcccagagctcgctaataaactggaagagcgaggtgcaaaagtcagctatctgtcg
ctctacgatagaaaaaaaccgatctattatgctcaaactttcttcatgctgcccgatatc
aatttaatatggataaccagtggagaaagtttgcgcaatctttcagaatacgtgtcgctg
cataaaccagaatggaaaacgctgcctatactcacacctagtatcagagtcaatcagcaa
gcaaaagaaatgggttggataaatgcctcgtgcgcaaatggcgctgacgataatagcttg
atcaaagcgacagaatttcacacaggaaaatag

DBGET integrated database retrieval system