KEGG   Marinomonas sp. MWYL1: Mmwyl1_3603Help
Entry
Mmwyl1_3603       CDS       T00567                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmwyl1_3603
Enzymes [BR:mmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mmwyl1_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4067404..4068321
Genome map
AA seq 305 aa AA seqDB search
MDYSVNKMQLPSPAKLNLFLHITGRREDGYHELQTLFQFIDLCDTLDFSLTRNNQITISP
IIEQLPTEDNLIYKAAKLLTPFKKDSTFGIDIILTKQLPMGGGIGGGSSNAATALLALNV
LWGCQLSLEKLAELGVQLGADIPVFVMGFAAFAEGVGEKLQKVELDTPYFLLIKPNCHVS
TGQIFTDKYLTRDTPPIRISHALKLGGHNDCLDVVKKHNPEVNEAYLWLKNYGDAKLTGT
GACLFLAFDNLRDAERVRSSTPTKWQSWVCRGCNTSPTHAALNQWIEQNRGVPHIKHHLS
QSFLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggactattcagtaaacaagatgcaactaccttctcctgcaaaattaaatttattttta
cacattacaggtcgacgagaagacggctatcatgagctacaaacattatttcagtttatc
gatttatgtgacacgctcgatttttcactaacaagaaataaccaaatcacaatttcacct
attattgagcagctccctacagaagataacctgatttataaagcggcaaaattactgaca
ccgttcaagaaagattcaacattcggcatcgatattatcttaacaaaacaattacctatg
ggtggtggaattggtggcggcagctcaaacgcagcaacagctttactagcgctaaacgtg
ttatggggatgccagctttctttggaaaagctagctgaattaggcgtgcaattaggtgcc
gacattcctgtttttgtcatggggttcgcagcctttgccgaaggcgttggagagaagctg
caaaaagtcgagttagatacaccgtattttttgctcattaagcccaattgtcacgtctca
actggtcaaatatttaccgataaatatttgacaagagacacccctcccatcagaatatcg
cacgccttgaagctgggtgggcataatgattgcttagacgtggtaaaaaagcacaatcct
gaggtgaatgaagcgtatctatggttgaaaaattatggtgacgcgaagcttacaggaaca
ggtgcttgtctatttttagcattcgataatttgcgcgacgccgaacgagtaagatcgtct
acaccgacaaaatggcagagttgggtttgccgtggctgtaacacttctccaacacacgct
gcgctaaaccagtggattgagcaaaatcgaggtgtgccacatataaaacaccacctcagc
cagtcttttcttggctaa

DBGET integrated database retrieval system