KEGG   Marinomonas sp. MWYL1: Mmwyl1_3764Help
Entry
Mmwyl1_3764       CDS       T00567                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmwyl1_3764
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmwyl1_3764
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mmwyl1_3764
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mmwyl1_3764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(4245218..4246603)
Genome map
AA seq 461 aa AA seqDB search
MKYISTRGKAPALSFGDVLLAGLANDGGLYVPETLPHYSKEEIASWANLSYQELAFKVMW
PFVEGDIPADAFKTMINDAYAGFNHTSIAPMVQVGNNEWILELFRGPTLAFKDFALQLLG
RLMDYVLSERKEKLVILGATSGDTGSAAIEGCRHSEHLNIFILHPYQRVSEVQRRQMTTV
IDDNVFNIAVKGNFDDCQGMVKSSFADQSFLKGAKLGAVNSINWARIMAQIVYYFSSALS
VGAPHRKVSFSVPTGNFGDIFAGYLAKKMGLPIDQLVVATNQNDILHRVIAENDMSRQSL
NVTLSPSMDIMVSSNFERLLFDAHGRDGVAIDDLMSRFNKGDVALNDQAWTYVKEYFDSY
KVDDEKTCEVIADVFAKTQYLLDPHTAIGLEAARHCWKDQSVPMITLATAHPVKFPEAVE
KAGCESPVLPEHMKDLFEREESYTVLDNSLSDVQAFVADKI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatttctactcgtggtaaagcgcctgcgctttcttttggtgatgtgttgtta
gctggtttggctaatgatggtggcttgtatgtaccagaaactttgcctcattacagcaaa
gaagaaattgcttcttgggctaatcttagctatcaagaattagcttttaaggtgatgtgg
ccgtttgtagagggcgatatcccagctgatgcctttaaaactatgattaatgacgcctat
gcaggttttaatcatacttctattgcgcctatggtgcaggttggcaataacgaatggatt
ctcgagttgttccgtggtccaacgttggcatttaaagattttgcattgcagctacttggt
cgtttgatggactatgtgttgtctgagcgtaaagagaaactggttattcttggtgccaca
tcaggtgatacagggtcggctgcgattgaaggctgtcgccactctgagcatttaaatatt
tttattttgcacccatatcagcgcgtttctgaagtgcaacgtcgtcaaatgacaacagtg
attgatgacaatgtgtttaatattgctgttaaaggcaattttgatgattgtcagggtatg
gtgaaatcaagttttgctgatcagtctttcttgaaaggtgctaagttgggtgcggttaac
tcgattaactgggcgcgaattatggctcaaatcgtttactacttttcttctgcattgtct
gttggtgctcctcatcgcaaagtgtctttctctgtaccaacggggaattttggtgatatc
tttgcgggttatttagcgaagaaaatgggcttgcctattgatcagcttgttgttgctacc
aatcagaatgacattctgcatcgtgtgattgctgaaaatgacatgagccgtcagtctttg
aatgtgactttgtcgccaagtatggacattatggtttccagtaactttgagcgtttgtta
tttgatgctcatgggcgcgatggtgtggctattgatgatttgatgtctcgttttaataaa
ggcgatgtggcattaaatgatcaagcttggacttatgttaaagagtactttgatagctac
aaagtggatgacgagaaaacgtgtgaagtgattgcggatgtattcgctaaaacgcaatat
cttcttgatcctcatacggccattggtcttgaagccgcgcgtcactgttggaaagatcag
tctgtgccaatgattactttggcaacagcacatcctgtgaaattcccagaagcggttgaa
aaagcaggttgtgaatcacctgttttgcctgagcatatgaaagacctttttgaacgagaa
gagtcctatactgttctagataatagtttgagtgatgtacaggcttttgtagctgataaa
atctag

DBGET integrated database retrieval system