KEGG   Marinomonas sp. MWYL1: Mmwyl1_3766Help
Entry
Mmwyl1_3766       CDS       T00567                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mmw  Marinomonas sp. MWYL1
Brite
Enzymes [BR:mmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Mmwyl1_3766
Secretion system [BR:mmw02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Mmwyl1_3766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4248062..4248778)
Genome map
AA seq 238 aa AA seqDB search
MKRFFCSLSRSAAITTLLSLSCAVFADQSAVLFAVQTALPQYEVESAKLHEGAGLYVVVL
KNGPTLHVTQDGKYFVAGDLYRIDNTTLENETEKAKLAKIETLPESQMIVYKAKDEKAHI
TVFTDVDCGYCRMLHKEVPKLNEAGVTVRYLAYPRAGIGSEAYTKMVSIWCSADPQEWLT
QAKLGAEIPENKCVNPVADQYKLGNEVGVRGTPSIVLDNGEFLPGYLPAAELVKHLGL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttttttctgttccctgtctcgctctgctgcaataactacgttgctttctctt
tcctgtgccgtatttgctgatcaatcagcagtcttatttgcagttcaaacggcgttgcct
caatatgaagtcgaaagtgcgaaattgcatgaaggcgcgggcttgtatgttgttgttttg
aagaacggtccaacattacatgtaacgcaagatggcaaatattttgtcgcgggtgatctt
taccgaatagacaatacaacgcttgagaatgaaacagaaaaagcaaaacttgccaaaatt
gaaacacttcctgaatcgcaaatgatcgtctacaaagcaaaggacgaaaaagcgcacatc
accgtatttacagatgttgattgtggttactgtcgaatgcttcataaagaagtgccaaaa
cttaatgaggcaggagttactgtccgctacttggcttacccaagagcgggaattggctca
gaagcctatactaaaatggtcagtatttggtgttcagcagatcctcaagagtggcttacg
caagcaaaattaggcgctgaaattcctgaaaacaaatgtgttaacccagttgcagatcag
tataaactaggcaacgaagtaggggtgcgtggtacgccaagtatagtgctagacaacggt
gagtttttaccaggatatttaccagcggctgagttggttaaacaccttgggttatag

DBGET integrated database retrieval system