KEGG   Marinomonas sp. MWYL1: Mmwyl1_3795Help
Entry
Mmwyl1_3795       CDS       T00567                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmw00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmw00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mmw00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4272870..4273781
Genome map
AA seq 303 aa AA seqDB search
MEDLLHSIEQKVKPLIGLGKVADYIPALANVDPNQFGIAIYSNNGELYHAGQAYTDFSIQ
SISKVFSLTLAIKHYGEDMWKRVGREPSGNPFNSLVQLEYEAGVPRNPFINAGALVISDM
NQSRFASPHYAMREFIRRLADNPHLNSDQIVANSEYEFRARNASMAYLMKAFGNFENDVE
DVLHSYFDNCAMRMNCVDLAKSFSFLANKGYSQLSGEQILSARETTQVNGLLATSGLYDE
AGNFAYRVGLPGKSGVGGGIIAIVPNRFSVCVWSPELNKSGNSLAGMAALEALSESIGWS
VFG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatttactgcattctatagaacaaaaagtaaaaccattaatcggtttaggtaaa
gtcgcagattacatccccgcattggctaatgtagaccctaatcaatttggcattgctatc
tacagcaacaacggcgagctttatcatgcaggccaagcctatacagatttctctatccaa
agtatttctaaagtctttagcttaacccttgccatcaaacactatggcgaagatatgtgg
aaacgcgttggacgagaaccttcaggtaatccgtttaattccttagtacagctagaatac
gaagctggcgtccctcgcaacccctttatcaatgctggcgctctagtaatcagcgacatg
aatcagtcccgttttgcctcaccgcattacgctatgcgagagttcattcggcgcttagcc
gataacccacatctgaattcagaccagatcgtcgccaattctgaatacgagttccgtgcg
cgcaacgcttccatggcgtatttaatgaaagcttttggtaattttgaaaacgacgtagaa
gatgtgttgcatagttacttcgataactgtgccatgcgcatgaattgcgtggatttagcc
aagtccttcagtttccttgcgaacaaaggctactcacagcttagtggtgaacaaatactg
agtgcacgagaaaccactcaagtaaacggcttactcgccaccagcggcttatacgacgag
gctggcaactttgcttatcgtgtaggactaccgggcaaaagcggcgttggtggtggcatc
atcgccattgtgcccaatcgtttttccgtatgtgtttggtcgccagaactcaataaatcg
ggtaactcactagctggcatggcagcgcttgaagcgctatcggaaagcatcggctggtca
gtgtttggttaa

DBGET integrated database retrieval system