KEGG   Marinomonas sp. MWYL1: Mmwyl1_3802Help
Entry
Mmwyl1_3802       CDS       T00567                                 

Definition
acetaldehyde dehydrogenase
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mmwyl1_3802
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmwyl1_3802
   00650 Butanoate metabolism
    Mmwyl1_3802
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmwyl1_3802
   00622 Xylene degradation
    Mmwyl1_3802
   00621 Dioxin degradation
    Mmwyl1_3802
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mmwyl1_3802
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Mmwyl1_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4283000..4283911)
Genome map
AA seq 303 aa AA seqDB search
MRKKLRAVIIGPGNIGTDLLIKMKRSDWIEPVWMVGIDPDSDGLKRARDMGIKTTHQGID
DFIDYLIADDIRIAFDATSAYVHEENSRKLNALGVVMIDLTPAAIGPYCIPPVNLEEHAN
NLEMNVNMVTCGGQATIPMVAAVSSVQKVDYAEIIATVSSRSVGPGTRANIDEFTRTTAS
AVEQIGGARKGKAIIVINPAEPPLMMRDTIHCLLSEDPDEVNISKSVYNMVKEVQKYVPG
YRLVNGPIFDGRKVSIFMEVEGLGDFLPTYSGNLDIMTAAALRTAEMFAERVASKAITLP
NRH
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaaattgcgagcggtcatcattggcccaggtaatattggaacggacttgttg
atcaaaatgaaacgatctgattggatcgagcccgtttggatggttggtatcgatccagat
tctgatggtttgaagcgtgctcgggatatggggattaaaactactcatcagggtattgat
gatttcattgactatcttattgctgatgatattcgtattgcatttgatgctacttcagcc
tacgtacatgaagagaatagtcgaaaattaaatgcgctgggtgtagtgatgatagacctt
actcccgcagccattggtccttattgtatccctccggtcaatttagaggagcatgcaaat
aatctagagatgaacgtcaatatggttacatgtggagggcaagcgactatacctatggtt
gctgcagtttcttctgttcaaaaagttgattacgccgagattattgcaacagtttcatct
cgttctgttggccctggaactcgagctaatattgatgagtttactcgaactactgcatct
gcggttgagcaaattgggggggcgagaaaggggaaagctattattgttattaaccctgca
gagcctccattaatgatgcgagatactattcactgtcttcttagtgaagatcctgatgaa
gtaaatattagcaaatccgtatataacatggtgaaggaagtacaaaaatatgttcctggc
tatcgattggtaaatggccccatttttgatggtcggaaagtgtctatttttatggaagtt
gaaggtttaggggatttcttacctacatattcgggcaatctagacatcatgacggctgca
gcgctaagaactgctgagatgtttgctgaacgagtagcttctaaggctatcactttgcct
aatcgccattga

DBGET integrated database retrieval system