KEGG   Marinomonas sp. MWYL1: Mmwyl1_3835Help
Entry
Mmwyl1_3835       CDS       T00567                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmw00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mmw00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4323910..4325157)
Genome map
AA seq 415 aa AA seqDB search
MNFFTELFSSVFDRRYRKARSNEEDNRTVKAMCQDLLTRHGEVSGGALARNILDRYDQMS
SDEKRELFEFMTHGLEVVTDEVITALTEYQKQPSKQTYKAFASACEPKRQELIRRFNQVP
GATPKLVKMREDLLKATKEDASLGILDVDFNHLFTSWFNRGFLVLRPINWDSPASILEKI
IAYEAVHAIDSWDDLRQRLKPSDRRCYGFFHPSMADDPLIFVEVALTKGTPSSIQSLLTT
DREIIEADEADTAVFYSISNCQPGLAGISFGNFLIKQVAANLARDLDNLNTFVTLSPIPG
LAKWANSAGMGALGQGKDQALAAYYLLNAKRPDGKPLDPVTRFHLGNGAMIQAVHADADV
SSNGLKQSNGAMVNYLYDLAQVSKNHEQFVTEQKVVASDAVHALSASIATRKKGE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttttacagaactgttttcttctgtttttgatcgccgttatcgcaaagcacga
tcgaatgaagaggataatcgaacagtaaaagccatgtgtcaggatttacttactcgtcat
ggtgaagtatctggaggcgcattagcgagaaatattctcgatcgttatgatcaaatgtcc
agcgatgaaaagcgtgaattatttgaatttatgactcacggtttagaagtggttactgat
gaagtgattaccgctttgacagaatatcaaaagcaaccaagcaagcagacttataaggcc
tttgcctcggcttgtgagccaaaacgacaagaacttattcgtcgctttaaccaagttcct
ggcgctacgccaaaattggtgaaaatgcgtgaagacttattaaaagccactaaagaagat
gcctcattagggattttagacgttgattttaaccatctattcacttcctggtttaatcgt
ggctttttggtgctacgtccaattaattgggacagtccagccagtattttggaaaaaatc
atagcttatgaagcggtgcacgccatcgatagctgggatgatttacgccaacgactaaag
ccttcagatcgtcgttgttatggcttttttcatccttctatggcggacgacccattaatt
tttgttgaggtcgcattaaccaaaggtactccgagctccatacaatctttgttgacgacc
gaccgagagataattgaagcagacgaagctgacaccgcagttttctattctatttctaac
tgccagcctgggttagcggggatatcgtttggtaatttcctcatcaaacaagttgctgca
aaccttgctagagacctcgacaatctaaatacctttgtgactctgtctcctattccaggt
ttggctaagtgggctaatagcgctggaatgggggctttagggcagggtaaagaccaagct
ttagctgcatattatctgctgaatgctaagcgtcctgatggtaaacctttagatcctgtt
acgcgttttcatctcggtaatggcgcgatgattcaagcggtgcatgccgatgcagacgtt
tcgtcaaacggcttgaaacagtcaaacggagccatggtaaattatttatacgacttagct
caggtttccaaaaatcacgaacagttcgtcacggaacaaaaagtagtggcatcggatgcg
gtacatgcgttgagtgcttctatcgcaactagaaaaaaaggagaataa

DBGET integrated database retrieval system