KEGG   Marinomonas sp. MWYL1: Mmwyl1_3953Help
Entry
Mmwyl1_3953       CDS       T00567                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mmwyl1_3953
Enzymes [BR:mmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mmwyl1_3953
Exosome [BR:mmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmwyl1_3953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4458596..4460080)
Genome map
AA seq 494 aa AA seqDB search
MTHYILAIDQGTTSSRAILFDEKGSRVGQSQQEFPQIFPDDGWVEHDPEDIWSSTLAVCR
SVLKDTGIDAQAIATIGITNQRETTILWDIDTGKPVYNAIVWQDRRTSGFCQSLSDQGLS
EKVQEKTGLLIDPYFSATKIRWILDNVDGARETAQSGRLAFGTVDSFLLWRLTNGKSHKT
DATNAARTMAFNIHTQEWDDELIELLGIGDVLFPEVMDCSADFGVIDASWLGAEIPVNGI
AGDQQAALVGQACFTPGMVKSTYGTGCFMILNTGDKAIRSEHKLLTTVGYRLNGKVTYAL
EGSIFVAGAAIQWLRDGLKLFADAKETQSLAKQALNDDSVYLVPAFTGLGAPYWDPDARG
AMIGLTRDTSVADIVSAGLRSVCYQTKDLVGAMAQDGATFSSLRVDGGMVINDVMVQFLS
DLLEITVERPCVTETTALGAAFLAGLQVGLYQSLDEIEVLWKADKCFEPTMEKGTGDKLY
QGWQKAVDRVRTRD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacattatattctggctattgatcaaggcaccaccagttctcgggctattttattt
gatgaaaaaggctctcgtgttggccaatctcagcaagaattcccacaaattttccccgat
gatggttgggttgagcatgatcccgaagatatttggtcatctactttagctgtgtgtcgc
tctgttctcaaggatacagggatcgacgctcaagcgatagcaactataggtatcaccaat
cagcgcgaaaccaccattttatgggacatcgacactggcaagcctgtttataatgccatt
gtttggcaagatcgacgtactagtggattttgccagtctttgagtgatcaaggattaagt
gaaaaagtacaagaaaaaaccgggctgctgattgatccatatttttctgcaaccaagatt
cgttggattttagacaatgttgatggtgcacgcgaaacagctcagtccggtcgtttggct
tttggtacggttgacagttttttattatggcgactgacaaatggcaagtcccataaaact
gatgcaacaaatgccgctcgtactatggcgtttaacatacatacgcaggaatgggatgat
gagctgatcgagctgttaggaattggtgatgtattgtttcctgaagtgatggattgtagt
gctgattttggtgtgattgatgcttcttggttgggcgctgaaattccagtcaatggtatt
gcaggagatcaacaggccgctttggttggtcaggcgtgttttactcccggcatggtgaaa
agtacttatggcacggggtgtttcatgattttaaacaccggtgataaagcgattcgatct
gaacataagttgctcactaccgtaggttatcgcctgaatggcaaagtcacttatgcatta
gaaggtagtatttttgtagctggcgccgcgattcaatggttacgagatggcttaaagtta
tttgctgatgctaaagaaacacaaagtctggccaagcaagcattgaatgatgattctgtt
tatttagtaccagcttttactgggttgggtgcgccatattgggacccagatgctcgtggt
gccatgattgggttaactcgtgatactagtgtcgctgatatcgttagcgctgggttgcgt
tctgtgtgttatcagacaaaagacttagttggtgctatggcacaagatggcgcaacattt
agctctttacgcgttgacggtgggatggtaataaacgatgtgatggtgcagttcttaagt
gatttgttagagatcacagtagagcgtccttgcgtgactgaaacaaccgctttgggcgct
gcgtttttagcgggtttgcaggttggcctttatcaatctttggatgagattgaagtcttg
tggaaagcagataaatgttttgagcccacaatggaaaaaggcactggtgataaattgtat
caaggctggcaaaaagccgtggatcgtgtgcgtacacgagactaa

DBGET integrated database retrieval system