KEGG   Marinomonas sp. MWYL1: Mmwyl1_3998Help
Entry
Mmwyl1_3998       CDS       T00567                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00860  Porphyrin and chlorophyll metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
Module
mmw_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmwyl1_3998
Enzymes [BR:mmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mmwyl1_3998
Exosome [BR:mmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmwyl1_3998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF1462
Motif
Other DBs
NCBI-ProteinID: ABR72894
JGI: Mmwyl13998
UniProt: A6W2G5
Position
4509521..4510516
Genome map
AA seq 331 aa AA seqDB search
MTFPYTRMRRMRKNDFSRRLMREHRLTTDDLIYPMFIIEGNNVREAIPSMPNIERLSIDL
LLEEAKELVELGIPTIALFPVVESDKKSLLAEEAYNPNGLVQRAVRALKESFPELGVLTD
VALDPYTTHGQDGIIDESGYVLNDITVDTLVKQALSHAQAGADIVAPSDMMDGRIGEIRD
ELEAEGFINTLIMAYAAKYASAYYGPFRDAIGSSGNLGKGNKFTYQIDPANSNEAIREVM
LDIEEGADMVMVKPGMPYLDIVRRVKTELEVPTFAYQVSGEYAMHMAAFQNGWLDKDTVM
MESLLAFKRAGADGILTYFAKDAARLLKTKS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacatttccatacactcgtatgcgccgcatgcgtaaaaatgatttttctcgccgcctg
atgcgcgagcatcgccttactacagacgatttaatctacccaatgtttattattgaaggc
aataatgtgcgcgaagccattccttccatgccaaacattgagcgcctttctatcgactta
cttttagaagaagccaaagagcttgtcgagttaggtatccctacgatcgcgctatttcct
gttgtcgaaagtgataaaaagtccttacttgctgaagaagcctacaatccgaatggttta
gtacaacgtgctgttcgcgctttaaaagagtctttcccagagcttggtgtattaacagat
gttgcgctagacccttataccactcacggccaagacggcatcattgatgaatcaggttat
gtgctgaatgacatcaccgtcgacacgctagtaaaacaagcactttcacatgcccaagca
ggcgctgacatcgttgcaccatccgacatgatggatggacgcattggtgaaatccgtgat
gaacttgaagctgaaggttttattaatacacttatcatggcatatgcagccaaatacgct
tcggcatactacggcccattccgtgatgcaataggttcaagcggtaaccttggtaaaggc
aataaatttacgtaccaaattgacccagccaactctaatgaagccatccgcgaagtgatg
ctcgatatagaggaaggcgcggatatggtcatggtaaaaccaggcatgccttatttagac
atcgtacgtcgagtgaaaacagaacttgaagtaccaacgtttgcttatcaagtaagtgga
gagtacgcaatgcacatggccgcctttcaaaatggctggctagataaagatacagtaatg
atggaatcactcctagcattcaaacgcgctggtgcagatggcatcctgacttattttgca
aaagatgcagcacgcctgctgaaaactaaaagctaa

DBGET integrated database retrieval system