KEGG   Marinomonas sp. MWYL1: Mmwyl1_4015Help
Entry
Mmwyl1_4015       CDS       T00567                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmwyl1_4015
Enzymes [BR:mmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mmwyl1_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4540011..4540493
Genome map
AA seq 160 aa AA seqDB search
MHAYIGLGSNLENPVAQLDRAIDTLKKHDDLKNLRVSSIYGSKPVGPQDQPDYINAVATF
ETNLSPIDLLDLLQSIEQSQRRVRERHWGPRTLDLDLLLYGQETIQSPRLTVPHPFMLER
GFVIKPLSDLAPDMLLANGKTVTEQLQQLDTNDLVFIKEE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttatattggcctcggcagtaatcttgaaaacccagtggcgcaacttgatcgc
gccattgacactctaaagaaacacgacgatttaaaaaaccttcgtgtttcttctatttat
ggcagcaagcccgttggtccacaagatcaaccagactatattaatgccgtcgcgacattc
gaaaccaacctctcccctatcgaccttcttgatttattgcaaagtatcgaacaatcacaa
cgtcgagtaagagaacgccattggggaccacgcaccctagacttagatctgttattgtac
ggacaagaaacaatacagtcaccaaggctaaccgtgccacaccccttcatgctagaacga
gggtttgtaataaagccgcttagcgacctagcgcctgatatgctcttagcgaatggaaaa
actgttaccgagcaattacagcaacttgataccaacgatttggtctttatcaaagaagaa
taa

DBGET integrated database retrieval system