KEGG   Marinomonas sp. MWYL1: Mmwyl1_4174Help
Entry
Mmwyl1_4174       CDS       T00567                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mmwyl1_4174
Enzymes [BR:mmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mmwyl1_4174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4734123..4734779)
Genome map
AA seq 218 aa AA seqDB search
MNNSTELIEIDIRQSIIDACISMNALHINQGTSGNISVRFGEGILITPTSMPYKTMTPED
IVWMGFDGQIVGNRAPSSEWNFHMEIMRRKPEVNAVVHAHPTACTTLSIMEKEIPPIHYM
VAVCGGHNIRCAPYATFGVSQLSENALQALEGRSACLLAHHGMIATAASLDKALWLAVEV
ETLAKQYLGCLSMGEPPLLSEEEIQNVINRMSGYGHAD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcaacagaattaatagaaattgatattcgccaaagcatcattgatgcctgt
atttcaatgaatgcgttgcacattaaccaaggcacatcgggcaatatttctgtgcgcttc
ggagaggggattcttattacaccgacatccatgccctacaagacgatgactcctgaagac
attgtttggatggggtttgatgggcagattgtgggcaacagagcaccttcgtctgagtgg
aattttcatatggaaattatgcgacgtaagcctgaagttaatgccgttgtgcatgcacac
cctacggcttgtacaactctatctattatggaaaaggaaataccacctatccattacatg
gtagctgtttgtggtggtcacaatattcgttgcgcaccttatgcaacgtttggggtcagc
caattatcggaaaatgcattgcaagcgctagaaggacgttctgcttgcttgcttgcacat
catggaatgattgctacggcggcgtcattggataaagcgctgtggctagctgtagaagta
gaaactcttgcgaaacaatatttaggttgtttgtcaatgggcgagccccctttgttatca
gaagaagagattcagaatgttatcaataggatgtctggttacggacatgctgattga

DBGET integrated database retrieval system