KEGG   Methanococcus maripaludis C6: MmarC6_0516Help
Entry
MmarC6_0516       CDS       T00615                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
476758..477492
Genome map
AA seq 244 aa AA seqDB search
MKVVITRPLEKGKDFSKMLEDAGFETIIIPTLELVFKKAEINLEKYSWIVFTSPRGIEGF
FRNLNSEDIDKVLSKKIGAIGIETAKEFEKIFKKPVDVIPELYTAENLLEALQKEVKIGE
KVLVPTTPSTRDILKEGLNADLIFVYSSEEPENISEKLKELEKQVFSENKDNKRVILTFT
SGLTAKNFFKHCRSEFLELLKEQHVVSIGPITKKNVDSLGFDSSMPEKNYTVEGMLSVIK
ALNI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtaattacaaggccgcttgaaaagggaaaagatttttcaaaaatgcttgaa
gatgcaggttttgaaacaataattattcctacacttgaactggtttttaaaaaagctgaa
ataaatcttgaaaaatattcgtggatagtttttacaagcccgaggggaattgaaggtttt
tttagaaatttgaattcagaagatatcgataaagttttatctaaaaaaataggtgcaata
ggaattgaaactgcaaaagaatttgaaaaaatctttaaaaaaccagtggacgttattcca
gaattatatactgcagaaaatttacttgaagcacttcaaaaagaagttaaaattggggaa
aaagtacttgttccaacaacgccctcgactagagatatcttgaaagaaggattaaatgca
gacttaatttttgtctacagctctgaagaaccagaaaacatatctgaaaaattgaaagaa
cttgaaaaacaggttttttctgaaaataaagataataaaagagtaattttaacatttaca
agtggacttactgcaaaaaacttctttaaacactgtagatcagaatttttagaactttta
aaagagcaacatgttgtctcaattggcccgataacaaagaaaaacgttgattctcttgga
tttgattcttcgatgcctgaaaaaaattacactgttgaaggaatgctctctgtgattaaa
gctttaaatatctga

DBGET integrated database retrieval system