KEGG   Methanococcus maripaludis C6: MmarC6_0624Help
Entry
MmarC6_0624       CDS       T00615                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mmx  Methanococcus maripaludis C6
Brite
Enzymes [BR:mmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     MmarC6_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(572722..574239)
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGENAVIVNDEDLKGTSYYPQDRVLIESHAGAVIGNIYSTKTMVKKGE
VGMLVKELKEVSISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEISEMTKRIAETGDMISWEKSLVVDIHSIGGVPGNKYALLS
IPILAAAGITIPKTSSRAITSPAGTADVMEVLTNVELKEEEIKRIVKTTNGCLAWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKNEAEGAKL
ARKFIELGELLNIKVECVLTYGGQPLGRAIGPALEAREAIEALQDPKNAPKSLIEKALSL
AGILLELGGAAQIGEGQKLAWEILESGRALEKFNQIITEQGGTPKKPEEIELGEYVEEII
APIDGYITDISNTAITNVVKEAGAPRDKKAGILLNSKIGNQVKQGDILYTIYSGSEERLV
SAVNLARRVYPVKVEGMLIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttaaatgcaaaattcatagatcttgatctgggtgaaaatgcggtaattgtt
aacgatgaggatttaaagggaacctcgtactacccgcaagatcgggtattgatagagtca
cacgcaggtgctgtgattggaaacatctattccacaaaaactatggttaaaaaaggcgaa
gttggaatgcttgttaaagaacttaaagaagtttctatctcagaaggggaagaggtaaaa
ttaaggcatgcagagaagccagaatcaattccatttataaaaaagaagatggatggtcag
gttttaaatccacatgaaataagaacgataatcgatgaaatcgtatctaaaaaactctca
aacatcgaattatccgcttttgtttcatctacgtatataaatggaatgaatatggatgaa
ataagcgaaatgaccaagagaattgcagaaaccggagatatgatttcctgggaaaagagt
cttgttgtagacattcacagtattggtggagttcccggaaataaatacgccttactttca
atcccgatacttgcagcagcaggaatcacaattccaaaaacgtcatctagggcaataaca
tctccagcaggaactgcagatgtaatggaagtactcacaaatgttgaattaaaagaagaa
gaaataaaaagaatagtaaaaactacaaacggatgtcttgcatggggtggtggtgtaaat
ctagcgcctgctgacgatattatcataaatgtagaacgaccggtttcaatagaccctcaa
cctcagcttcttgcaagtgttatggcaaaaaagattgcaacaggaattaaatatactgta
atagatattcctgttggaaaaggagtaaaaattaaaaatgaggcggaaggagcaaaatta
gcgaggaaatttattgaacttggagaattgttaaatattaaggtagaatgtgtcttaact
tacggcggacagcctcttggaagggcaattggacctgcactcgaagcaagagaagcaatt
gaagcacttcaagatccaaaaaatgctccaaaaagtttaattgaaaaagcactatcgctt
gcaggaattcttcttgaactcggtggtgctgcacagattggggaaggtcagaaacttgca
tgggaaattttggaatccggaagggctcttgaaaaattcaatcagattataactgaacag
ggtggaactccgaaaaaacctgaagaaatagaacttggagaatacgttgaagaaattatt
gctccaattgatggatacattaccgatataagtaatactgcaattacaaacgtggttaaa
gaagctggagctccaagggacaaaaaagcaggaatattattgaattcaaagattggaaat
caggtcaaacagggggatatattatatacaatttattctggttcagaagaacggctagtt
tcagcagtaaatcttgcaagaagagtttatcctgtaaaagttgaaggaatgcttatcgag
agaataagcaaattctaa

DBGET integrated database retrieval system