KEGG   Methanococcus maripaludis C6: MmarC6_0626Help
Entry
MmarC6_0626       CDS       T00615                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00010  Glycolysis / Gluconeogenesis
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
mmx01230  Biosynthesis of amino acids
Module
mmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmx_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0626
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MmarC6_0626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C TrkA_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABX01443
UniProt: A9A6M9
Position
576575..577597
Genome map
AA seq 340 aa AA seqDB search
MVNVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEARMAVEKGYKLFAAIPERKHL
FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS
FNSLWSYNRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDVKTGP
VNAIVPNPVSVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII
DALAKTPRILTLKASEGFDSTAKIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA
IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKAMGLIK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgtattgataaacggatacggctctatcggtaaaagggttgccgatgcagta
gctaaacaggacgatatgaaagttataggggttacaaaaacaaaacctgactttgaagct
agaatggctgttgaaaaaggatacaaattattcgcagcaattcctgaaagaaagcatctt
tttgaagaagctggaattcctgttgaagggacactcgatgatatcattgaagatgcagat
atcgtagttgacggggctcctaaaaaaattggaaaagcaaacctcgaaaatgtatacaaa
aaacacggcgtaaaggcaataatccaaggtggagaaaaagcaggtgatgcacaagattca
tttaattcactctggagctacaacagatgctatgggaaagattacatcagactcgtatca
tgcaacaccacaggactctgtagatcaatgtatgcaattaattcagttgctgacatttta
aaagcaagaatagttttaataagaagagctgctgatcctaacgacgtgaaaaccggacca
gtaaacgcaatcgttccaaatccagtatctgttccatcacaccacggaccggacgttgta
tcagttattcctgagctcgatggaaaaatcatgacttcagcagttatcgttccaacaaca
ttaatgcacatgcactcaataatggtagaaacttctggaacgaacagagacgaaataata
gatgcacttgcaaaaacaccaagaatattaacattaaaagcttcagaaggatttgattca
actgcaaagatcattgaatacgcaagagaccttggaagaagcagatacgacttaaacgaa
attgcagtatgggaagaaagcgtaaacgttgtggacaatgaagtttacatgatgcaggca
atccaccaagaaagcgatgttatccctgaaaacgtggactgtatcagagcaatgctagaa
atggaaagcgacaacttaaaatcaattgaaaaaaccaataaagcaatgggtttaattaaa
taa

DBGET integrated database retrieval system