KEGG   Methanococcus maripaludis C6: MmarC6_0634Help
Entry
MmarC6_0634       CDS       T00615                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC6_0634
   01230 Biosynthesis of amino acids
    MmarC6_0634
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0634
   00030 Pentose phosphate pathway
    MmarC6_0634
   00051 Fructose and mannose metabolism
    MmarC6_0634
  Energy metabolism
   00680 Methane metabolism
    MmarC6_0634
Enzymes [BR:mmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MmarC6_0634
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC6_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(584624..585775)
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDEILIDYYVTNCGDDIDMIMT
HDKGTDNEEVHKLAWDALEAATEVAKELKLYGAGQDLLSNSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYKMFADPFSTAGLVYDPSMTSGFRYEILDVFAHKRVF
LDAPEEIYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVAEEDAMPARFDGPARVMALGFQLS
HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFIEMEETCECKIDEIRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaactctaagtgttattaaggcagacgttggcgggctttgtggacac
acattagctccagaagaattactcgatgctgcagagtacgttcttgaaaatgcactcgat
gaaattttaattgattattatgttacaaactgtggtgacgatatcgacatgataatgacc
cacgataaaggtactgacaacgaagaagtacacaaacttgcatgggatgctcttgaagca
gcaacagaagttgcaaaagagttaaaattatatggtgcaggtcaggacttactttcaaac
tcattttccggaaatgtcaaaggacttggtccaggatgcgctgaaatggaatttgttgaa
agaccaagtgaacctgttgtagtattctgctgtgacaaaacagaccctgcagcatttaac
ttaccattctacaaaatgtttgcagacccattcagcactgcaggattagtatacgaccct
tcaatgacatcaggattcagatacgaaatcttagatgtttttgcacacaaaagagtattt
ttagatgctccagaagaaatatattcattactcgcattaatcggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaacgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgcaggagaatacgttggaaaagatgaccctgtagcaatcgtaaga
gctcaaagtggattccctgcagtaggggaagttttagagggattcgcaaacccacacctc
gttgcaggatggatgagaggatgtcactttggacctatcatgcctgttgctgaagaagat
gcaatgcctgcaagatttgacggacctgcaagagttatggctttaggattccagttatcg
cacggaagattagttggaccaaacgacctctttgcagacaaatcattcgataaagcaaga
gaaaaagcacttgatatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttacctgaatcaatgatggaatatacatcagttccaaaagttttagcacagttaaaagac
agattcattgaaatggaagaaacatgcgagtgcaaaattgatgaaataagagaaagaggg
gacatggaataa

DBGET integrated database retrieval system