KEGG   Methanococcus maripaludis C6: MmarC6_0634Help
Entry
MmarC6_0634       CDS       T00615                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00010  Glycolysis / Gluconeogenesis
mmx00030  Pentose phosphate pathway
mmx00051  Fructose and mannose metabolism
mmx00680  Methane metabolism
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
mmx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0634
   00030 Pentose phosphate pathway
    MmarC6_0634
   00051 Fructose and mannose metabolism
    MmarC6_0634
  Energy metabolism
   00680 Methane metabolism
    MmarC6_0634
Enzymes [BR:mmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MmarC6_0634
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC6_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3 HSBP1
Motif
Other DBs
NCBI-ProteinID: ABX01451
UniProt: A9A6N7
Position
complement(584624..585775)
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDEILIDYYVTNCGDDIDMIMT
HDKGTDNEEVHKLAWDALEAATEVAKELKLYGAGQDLLSNSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYKMFADPFSTAGLVYDPSMTSGFRYEILDVFAHKRVF
LDAPEEIYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVAEEDAMPARFDGPARVMALGFQLS
HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFIEMEETCECKIDEIRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaactctaagtgttattaaggcagacgttggcgggctttgtggacac
acattagctccagaagaattactcgatgctgcagagtacgttcttgaaaatgcactcgat
gaaattttaattgattattatgttacaaactgtggtgacgatatcgacatgataatgacc
cacgataaaggtactgacaacgaagaagtacacaaacttgcatgggatgctcttgaagca
gcaacagaagttgcaaaagagttaaaattatatggtgcaggtcaggacttactttcaaac
tcattttccggaaatgtcaaaggacttggtccaggatgcgctgaaatggaatttgttgaa
agaccaagtgaacctgttgtagtattctgctgtgacaaaacagaccctgcagcatttaac
ttaccattctacaaaatgtttgcagacccattcagcactgcaggattagtatacgaccct
tcaatgacatcaggattcagatacgaaatcttagatgtttttgcacacaaaagagtattt
ttagatgctccagaagaaatatattcattactcgcattaatcggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaacgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgcaggagaatacgttggaaaagatgaccctgtagcaatcgtaaga
gctcaaagtggattccctgcagtaggggaagttttagagggattcgcaaacccacacctc
gttgcaggatggatgagaggatgtcactttggacctatcatgcctgttgctgaagaagat
gcaatgcctgcaagatttgacggacctgcaagagttatggctttaggattccagttatcg
cacggaagattagttggaccaaacgacctctttgcagacaaatcattcgataaagcaaga
gaaaaagcacttgatatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttacctgaatcaatgatggaatatacatcagttccaaaagttttagcacagttaaaagac
agattcattgaaatggaagaaacatgcgagtgcaaaattgatgaaataagagaaagaggg
gacatggaataa

DBGET integrated database retrieval system