KEGG   Methanococcus maripaludis C6: MmarC6_0660Help
Entry
MmarC6_0660       CDS       T00615                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC6_0660
   01230 Biosynthesis of amino acids
    MmarC6_0660
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0660
   00030 Pentose phosphate pathway
    MmarC6_0660
   00051 Fructose and mannose metabolism
    MmarC6_0660
  Energy metabolism
   00680 Methane metabolism
    MmarC6_0660
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC6_0660
Enzymes [BR:mmx01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MmarC6_0660
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC6_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
607032..607958
Genome map
AA seq 308 aa AA seqDB search
MVKKITRDDVLIPLETPEAMHEEYIQNYLKLTRNTGNLMLFAGDQKIEHLNEDFYGKDIS
KDDANPEHLFKIAKNSKIGGFAVQFGLISRYGRDYKDINYIVKLNSKTNLVETNQKDPIS
RALLNINDILELKKNSGINIVGVGYTIYLGSEYESEMLSEASKIIYEAHKGGIVVILWIY
PRGKAVKDEKDSELIAGATGVAACLGADFVKVNYPKSENPAESFKEAVMAAGRTKVVCAG
GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLPDAISMCNAIYAITIDGKTVSEAL
NIYNERKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaaaaataacccgtgatgacgtattaattccgctggaaactccagaagcaatg
catgaagaatacatacaaaattacctgaaacttacaagaaatacaggtaatctgatgctt
tttgcaggcgatcaaaaaatcgaacatttgaacgaagatttttacggaaaagatatttca
aaagatgatgcaaatccagaacacctgtttaaaattgctaaaaattcaaaaataggtggt
tttgcagttcagttcggattaatatcgagatacggcagagattataaagatataaattac
atcgtaaaattaaattcaaaaacaaatcttgtagaaacgaaccaaaaagacccgataagc
cgtgcattgttaaatattaacgatattttggagttaaagaaaaattctggaattaatata
gttggagtaggatacacaatctatcttggaagtgaatatgaatcagagatgctttctgaa
gcttcaaaaataatttatgaagcccataaagggggaattgttgtaattctctggatttac
ccgcggggaaaagctgtaaaagatgaaaaagactcagaactaattgctggagctacgggt
gttgcagcgtgtcttggagctgattttgtaaaagtaaattacccaaaatcagaaaatcct
gcagaatcatttaaagaagccgttatggctgccggaagaactaaagtagtctgtgcaggc
ggatcaagtacagatattgaatcatttttaaaacagctttacgaacagattcacataagc
ggggcatcaggaaacgccactggacgaaatatccatcaaaaatcattgccagatgccata
tcaatgtgtaatgcgatatatgcaataacaattgacggaaaaactgtttcagaagcttta
aatatatacaacgaaagaaaatcttaa

DBGET integrated database retrieval system