KEGG   Methanococcus maripaludis C6: MmarC6_0660Help
Entry
MmarC6_0660       CDS       T00615                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00010  Glycolysis / Gluconeogenesis
mmx00030  Pentose phosphate pathway
mmx00051  Fructose and mannose metabolism
mmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmx00680  Methane metabolism
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
mmx01230  Biosynthesis of amino acids
Module
mmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0660
   00030 Pentose phosphate pathway
    MmarC6_0660
   00051 Fructose and mannose metabolism
    MmarC6_0660
  Energy metabolism
   00680 Methane metabolism
    MmarC6_0660
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC6_0660
Enzymes [BR:mmx01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     MmarC6_0660
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC6_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ABX01477
UniProt: A9A804
Position
607032..607958
Genome map
AA seq 308 aa AA seqDB search
MVKKITRDDVLIPLETPEAMHEEYIQNYLKLTRNTGNLMLFAGDQKIEHLNEDFYGKDIS
KDDANPEHLFKIAKNSKIGGFAVQFGLISRYGRDYKDINYIVKLNSKTNLVETNQKDPIS
RALLNINDILELKKNSGINIVGVGYTIYLGSEYESEMLSEASKIIYEAHKGGIVVILWIY
PRGKAVKDEKDSELIAGATGVAACLGADFVKVNYPKSENPAESFKEAVMAAGRTKVVCAG
GSSTDIESFLKQLYEQIHISGASGNATGRNIHQKSLPDAISMCNAIYAITIDGKTVSEAL
NIYNERKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaaaaaataacccgtgatgacgtattaattccgctggaaactccagaagcaatg
catgaagaatacatacaaaattacctgaaacttacaagaaatacaggtaatctgatgctt
tttgcaggcgatcaaaaaatcgaacatttgaacgaagatttttacggaaaagatatttca
aaagatgatgcaaatccagaacacctgtttaaaattgctaaaaattcaaaaataggtggt
tttgcagttcagttcggattaatatcgagatacggcagagattataaagatataaattac
atcgtaaaattaaattcaaaaacaaatcttgtagaaacgaaccaaaaagacccgataagc
cgtgcattgttaaatattaacgatattttggagttaaagaaaaattctggaattaatata
gttggagtaggatacacaatctatcttggaagtgaatatgaatcagagatgctttctgaa
gcttcaaaaataatttatgaagcccataaagggggaattgttgtaattctctggatttac
ccgcggggaaaagctgtaaaagatgaaaaagactcagaactaattgctggagctacgggt
gttgcagcgtgtcttggagctgattttgtaaaagtaaattacccaaaatcagaaaatcct
gcagaatcatttaaagaagccgttatggctgccggaagaactaaagtagtctgtgcaggc
ggatcaagtacagatattgaatcatttttaaaacagctttacgaacagattcacataagc
ggggcatcaggaaacgccactggacgaaatatccatcaaaaatcattgccagatgccata
tcaatgtgtaatgcgatatatgcaataacaattgacggaaaaactgtttcagaagcttta
aatatatacaacgaaagaaaatcttaa

DBGET integrated database retrieval system