KEGG   Methanococcus maripaludis C6: MmarC6_0802Help
Entry
MmarC6_0802       CDS       T00615                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC6_0802
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0802
   00620 Pyruvate metabolism
    MmarC6_0802
   00640 Propanoate metabolism
    MmarC6_0802
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC6_0802
   00680 Methane metabolism
    MmarC6_0802
Enzymes [BR:mmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MmarC6_0802
Lipid biosynthesis proteins [BR:mmx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MmarC6_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(743828..745738)
Genome map
AA seq 636 aa AA seqDB search
MKTGDKYIMLEKYSEMQQKALDDPEKFWGEQAKCLEWDKTWDKVLEWNPPYAKWFKGGSL
NASYNCVDRHIKGNRRNKAAIICEKEDGSCGILTYYELYREINKFANVLENLGVEKGDVV
TIYMPMMTEAIIAMLACSRIGAIHNVVFSGFSSDALADRINDSKSKILVTTNLLYRRGKE
IDLKKILDKALLNCNSIKHVVYAKRGSEEFNLVSGKEYFWDELMGGAKSYVEPVPVESEH
PLFILYTSGTTGSPKGVVHSTGGYLTYATKTMDWTWGLNEMDVFWCTADIGWITGHTYVV
YGPLSLGATIVLYEGAIDYPEPDRLWGIVENHGVTLLYTAPTAIRMLMMYGEKWVTNHDL
STLRLLGSVGEPINPRAWKWYYKVIGKEKCPICDCYWQTETGGHMIYPAIGIQSVPLKPG
SATFPGIGIDVDVVDNEGNPVDANVKGNLIIKRPWPGMLAGLWNNDERYRAAYWDRFKNK
FSTSDYAIKDQDGYIWVLGRSDEVLNVSGHRIGTAELEHELVSNKMVAESAVVGKPDDVK
GEVPVAFVILNEKYRELPANEVKATLIRHIRDTVGPIGTPAMIFFVNKLPKTRSGKIMRR
ILKKLIIGEEIGDVTTLEDNTSLEEVKKELEDFKYD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactggagacaaatatataatgctcgaaaaatattctgaaatgcagcagaaagct
ttggatgaccctgaaaaattttggggagaacaggcaaaatgtttagaatgggataaaact
tgggataaagtactggaatggaatccaccttacgcaaaatggtttaaaggcggtagttta
aacgcaagctacaattgtgttgataggcacataaaaggaaataggagaaataaagctgct
ataatctgcgaaaaagaggatggtagctgtggaatcttaacatattacgaattataccga
gaaataaacaaatttgcaaatgttctcgagaatctgggggtcgaaaaaggtgatgtagtc
acaatttacatgcctatgatgacagaggcaattattgcaatgcttgcatgttcgagaatc
ggggcaatccacaacgtcgtattttctggattttcatcagatgccctcgctgacagaata
aatgactcaaaatcaaaaatattggtgactactaacttattatacaggcgaggaaaagag
attgacctcaaaaaaatactggataaagcattattaaattgtaattcaataaaacacgta
gtttatgcaaaaaggggcagtgaagaatttaatttagtttcaggaaaagaatatttctgg
gatgaattaatgggtggtgctaaaagctatgtagaaccagttcccgtagaatcagagcac
ccgctatttattctctataccagtggtacaacaggaagtccaaaaggggtagttcactca
acaggcggatatttaacttacgctacaaaaaccatggattggacctggggattaaatgaa
atggatgtattttggtgtactgcagacattggatggattactggacacacttacgtggtg
tacggcccattatcactaggtgctacgatagtactctatgaaggcgcgatagattacccc
gaacctgatagattatggggcattgtggaaaatcacggagttacattactatacaccgca
ccaactgcgataagaatgctcatgatgtacggtgaaaaatgggtaactaaccacgattta
tcaacactgaggcttttaggaagtgttggggaaccaataaatccaagagcttggaaatgg
tactacaaagtaattggaaaagaaaaatgcccaatttgtgactgttactggcaaacagaa
actggtggacacatgatatatcctgcaattggaatccagtcagttccattaaaaccgggg
tcagcaacgtttccgggaatcggaattgatgtcgatgtcgtagacaacgaaggaaatccc
gtcgatgcaaatgtaaaaggaaatcttattataaaacgaccatggccaggaatgcttgcg
ggattgtggaataacgatgaaagataccgtgcagcatactgggatagatttaaaaataaa
ttttcaacatctgactatgcaataaaagaccaagatggatatatctgggtactgggtcga
tctgacgaagtattaaatgtttctgggcacagaataggaacagcagagctcgaacacgaa
cttgtatcaaacaagatggtcgcagaatcagcagtagttggaaaacctgacgatgtaaaa
ggggaagttcctgttgcatttgtcatattaaacgaaaaataccgtgaacttcccgcaaat
gaagtaaaagctacgcttattaggcatatccgggacactgtcggtccaataggaactcct
gcaatgatattcttcgtaaataaacttccaaaaacaagaagtggaaaaataatgagaaga
atattgaaaaaactcataattggcgaagagataggcgatgttacaacgctagaagacaac
acgagtctcgaagaagttaaaaaagagcttgaagatttcaagtacgattaa

DBGET integrated database retrieval system