KEGG   Methanococcus maripaludis C6: MmarC6_0817Help
Entry
MmarC6_0817       CDS       T00615                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00260  Glycine, serine and threonine metabolism
mmx00750  Vitamin B6 metabolism
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01120  Microbial metabolism in diverse environments
mmx01230  Biosynthesis of amino acids
Module
mmx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MmarC6_0817
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MmarC6_0817
Enzymes [BR:mmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MmarC6_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX01634
UniProt: A9A8G1
Position
complement(761366..762580)
Genome map
AA seq 404 aa AA seqDB search
MIQKCRVCGKEYEVDAIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
VKDPAKIVSLHEGGTPLYKCENLAKKLGMKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETGMIDTLPKMTGIQAEGAQPIVKAIKAGLDEIVPEENPETIATAIRIGNP
VNAAKALEAIKSSGGLAESVNDEEIIAAQKLLAQTEGIFVEPASASSIAGLIKLIDMGLI
DKDQKIVCITTGNGLKDPDAAIKASTMPTEIECDMEVLRKAIEE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgcagagtatgcggaaaagaatacgaagtagacgctataatttataac
tgcgaatgtggcggattacttgaaattaaatacgattttgaaagtatcaaagaaaaagtt
tcaaaagagtccttaagagaaagagaactcggtgtatggagatatttagattacttacct
gttaaagatcctgcaaaaattgtaagccttcacgaaggaggaactcctctttacaaatgt
gaaaatctcgcaaaaaaattaggaatgaaagagttgtacgttaaaaacgaaggtgcaaac
ccaacaggaagtttcaaagataggggaatgactgttggagttacaagagcaaacgaactc
ggtgttgaagtagtagggtgtgcttcaaccggaaacacctctgcatcccttgcagcatac
tctgcaagagcaggcaaaaaatgtattgttctcctcccgggaggaaaagtggcgcttgga
aaacttgctcaagcaatgttttacggtgcaaaagttatccagatcaacggaaactttgac
gaagctctcgtaatggttaaaaaccttgcattagaaaacaaactctacttattaaactca
gtaaacccattcagacttgaaggtcagaaaacaattggttttgaaatctgcgaccagtta
gactttgaagttccagacatggttattttacctgttggaaacgctggaaacatcagtgca
atctggaaaggatttaaagaatttaaagaaacaggaatgattgacaccttaccaaaaatg
actggaattcaggcagaaggtgcacagccaatcgtaaaagcgataaaagcaggacttgat
gaaatagttcctgaagaaaatcctgaaacgatcgcaactgcaattagaatcggaaacccg
gtaaacgctgcaaaagcactcgaagcaatcaaatcttcaggtggacttgcagaaagtgta
aacgatgaagaaattatcgcagctcagaaactcttagcacaaacagaaggaattttcgta
gaacctgcttcagcttcatcaatcgcaggtcttatcaagttaatagatatgggattaatt
gacaaagatcaaaaaatcgtatgtattacaaccggtaacggattaaaagatcctgatgcg
gcaatcaaagcaagtacaatgcctacagaaattgaatgtgacatggaagtactcagaaaa
gcaatagaagaataa

DBGET integrated database retrieval system