KEGG   Methanococcus maripaludis C6: MmarC6_1014Help
Entry
MmarC6_1014       CDS       T00615                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MmarC6_1014 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MmarC6_1014 (pyrB)
Enzymes [BR:mmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MmarC6_1014 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
959118..960026
Genome map
AA seq 302 aa AA seqDB search
MRHLISMRDIGREEILNILDESERMEAILNEKGHCDFLNGRILATLFYEPSTRTRLSFET
AMKRLGGNVIGFTDISNTSVTKGESLADTIKVISGYSDLIAIRHPSEGAARLSSENSKVP
VINAGDGSNQHPTQTLLDLYTIKREVGHIENLKIAFIGDLKYGRTVHSLCQALSLFKGVE
IKLISPDELKMPREVIEDISGKIKLSEMTDVEIDDVDVVYMTRIQKERFVDVNEYYKVKG
IYRLSKEHIGDKNVVIMHPLPRVDEIDSEVDTLPQARYFKQSFYGVPVRMAILKLLFEDS
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatttaatttcgatgagggacatcggtcgggaagaaattttaaatattttggac
gaatccgaaagaatggaagctattttaaatgaaaaaggtcactgcgactttttaaatgga
agaatactcgcaactcttttttatgaaccatcaaccaggacaagactttcttttgaaact
gcaatgaagcggcttggtggaaatgttatcggttttacagatatttcaaacacttctgta
acaaagggcgaatctttagcagatactatcaaagtaatcagtggttacagtgatttgatt
gcaataagacacccttcagaaggtgctgcaaggctttcaagtgaaaattcaaaagttcct
gttataaacgctggcgatggatcaaaccagcacccgacacagacgcttcttgatttgtac
acgattaaacgagaagttggacacattgaaaatttaaaaattgcatttattggggatttg
aagtacggaagaaccgttcactctttgtgtcaggcgttatctctctttaaaggtgtagaa
ataaaattaatttctccagacgaacttaaaatgccaagggaagtaattgaggacattagt
ggaaaaataaaactttcagaaatgactgatgttgaaattgacgatgttgatgttgtttac
atgacaaggattcagaaagaaaggtttgttgatgttaatgaatactacaaggtaaaagga
atataccggctttcaaaagagcatattggggacaaaaatgtagtcatcatgcacccgctt
ccaagagttgatgaaatcgattctgaagttgatactcttccacaagcaagatactttaaa
cagtcattttatggggttcctgtcagaatggcgattttgaagcttttatttgaagattcg
gtaaaataa

DBGET integrated database retrieval system