KEGG   Methanococcus maripaludis C6: MmarC6_1093Help
Entry
MmarC6_1093       CDS       T00615                                 

Definition
ELP3 family histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmx  Methanococcus maripaludis C6
Brite
Enzymes [BR:mmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MmarC6_1093
Transfer RNA biogenesis [BR:mmx03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MmarC6_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1031421..1033046
Genome map
AA seq 541 aa AA seqDB search
MNDYSEFIRCIISNLLAEKEKIKDLDPKRKKQKVEDIKARCLRKFDLNVGFPPNSDIIGQ
ASEEEKKELLPLLRKKPIRTLSGVAVVAVMTSPEPCPHGKCSFCPGGKESNFGDVPQSYT
GKEPATMRGVMYNFDPYVQTSERLSQLEKVGHPTDKVELIIMGGTFPARDIEYQENFIKR
CLDAMNGEVSETLEQAQEKNETAKHRCVALTLETRPDYCNEKEINEMLKLGTTRVELGIQ
STNDEVLEFVKRGHGIDASIKATQLLKDSGLKVSYHLIPGLPKTTPEMDKETIKTVFENP
NFKPDLIKFYPCLVIPGTEVYELWQSGEFIPMNDEQAVEVITYGKSIMPKWVRTSRIQRD
IPVTVIDAGVKKSNLGELVYNNLEENGIKCKCIRCREVGHVTYKKGIKPDLESITLCRED
YESSGGKEIFLSFEDTKNDLLIGYLRLRIPNNPFRKEITDKTALIRQVHICGQQKELESS
SKELSWQHKGYGRLLIDEAEKIAKVEFEKDQMLINSGIGVREYYKKLGYKRVGPYMSKIL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgactattcagaatttatacgatgtatcatttctaatcttttagctgaaaaggaa
aaaataaaggatctggatccaaagaggaaaaaacaaaaggtggaagatatcaaggcgaga
tgtcttcgtaaatttgatttaaatgttggttttcctccaaattcagatattattggtcag
gcttcagaagaagaaaaaaaggaattacttccccttttaagaaaaaaaccaataagaaca
ctttcaggtgttgcagtggttgcagtgatgacttcacctgaaccatgtccgcatggaaaa
tgttcgttctgccccggtggaaaagaaagtaattttggagacgttccgcaaagttatact
ggaaaagagcctgcaacaatgcgtggagtgatgtataactttgacccatacgttcagacg
agtgaaaggctttcgcaacttgaaaaagtgggacatccgacagataaggtggaactgata
ataatgggcggaacttttccagcaagggatatagaatatcaggaaaacttcataaaaaga
tgtcttgatgcgatgaacggtgaagtttctgaaacactagaacaggcacaggaaaaaaac
gaaactgcaaagcacaggtgtgtagccctcactcttgaaacaaggcctgattattgcaat
gaaaaggaaataaatgaaatgcttaaacttggaaccacgagagttgaacttggaattcaa
agcacaaacgatgaagttttagagtttgtaaaacggggacacgggatcgatgcatcaatt
aaggcaacccagcttttaaaagatagcggtttaaaagtttcgtaccacttaatccccgga
cttccaaagacaactcctgaaatggacaaagaaacaattaaaacagtatttgaaaatcca
aacttcaaacctgatttaattaaattttatccctgccttgtaattcccggaacagaggtc
tatgaattgtggcaaagtggggaatttattccaatgaacgatgaacaggctgtagaagtt
attacctatggaaaatcaatcatgccaaaatgggtaaggacctcaagaattcaaagagat
attcctgtaactgtgattgatgccggagttaagaaaagtaaccttggagaactcgtatac
aataatttggaagaaaacggaataaaatgtaaatgtatacggtgcagagaagtcgggcac
gtaacatacaaaaaaggaataaaacctgatttagaaagtattactttatgcagggaagac
tacgaatcaagtggcggaaaagagatatttttatcgtttgaagataccaaaaacgatctt
ttgataggatatttaagacttagaattccaaataatccatttagaaaagaaataaccgat
aaaactgcacttataaggcaggttcatatttgtggacagcaaaaagaactcgaaagtagc
tcaaaagaactttcatggcagcacaagggttatggaagacttttgattgacgaagctgag
aaaatcgcaaaagttgagttcgaaaaagaccagatgttgatcaacagtggaattggagtc
cgggaatactataaaaaactcggatacaaaagagtaggcccttacatgagtaaaattctt
aaataa

DBGET integrated database retrieval system