KEGG   Methanococcus maripaludis C6: MmarC6_1167Help
Entry
MmarC6_1167       CDS       T00615                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mmx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmx00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmx00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmx00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmx00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mmx00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmx00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mmx00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1095559..1096089
Genome map
AA seq 176 aa AA seqDB search
MIEVRFHGRGGQGAVTAAQILAKAAFYDGKSCQAFPFFGVERRGAPVMAFTRIDDEKIRL
RSQIYEPDYVIVQDPTLMDSVDVTSGLKSGGKILINTLKDIKLEGYDVKTIDATGISLDV
LGVPIVNTTLCGAFAGITGEVTIESLKKAILETFPGKLGPKNAEAAENAYNLIKGL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagttagattccacggaagagggggacagggtgcagtaacagcagctcaaatt
cttgccaaagctgcattttacgacggtaagtcctgtcaggcttttccattctttggtgtg
gaaagaagaggggctcccgtaatggcatttacaagaattgacgatgaaaaaataagattg
aggagccaaatttacgaaccagattatgtaattgtacaggatccaacattaatggattca
gtagatgttacaagcgggctcaaaagtggcggaaaaatattgataaacactttaaaagac
ataaaactcgaaggctacgacgttaaaacaatagatgctacaggaatatcattagatgtt
cttggagttcctatcgtaaacacgacgctttgtggagcttttgctggaattactggagaa
gttactatcgaatcacttaaaaaagcaattttagaaacatttcctggtaaattaggacct
aaaaatgcagaagcagcagaaaacgcatacaatctaataaaaggtctgtaa

DBGET integrated database retrieval system