KEGG   Methanococcus maripaludis C6: MmarC6_1168Help
Entry
MmarC6_1168       CDS       T00615                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00010  Glycolysis / Gluconeogenesis
mmx00020  Citrate cycle (TCA cycle)
mmx00620  Pyruvate metabolism
mmx00633  Nitrotoluene degradation
mmx00640  Propanoate metabolism
mmx00650  Butanoate metabolism
mmx00680  Methane metabolism
mmx00720  Carbon fixation pathways in prokaryotes
mmx01100  Metabolic pathways
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
Module
mmx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmx_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_1168
   00020 Citrate cycle (TCA cycle)
    MmarC6_1168
   00620 Pyruvate metabolism
    MmarC6_1168
   00640 Propanoate metabolism
    MmarC6_1168
   00650 Butanoate metabolism
    MmarC6_1168
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC6_1168
   00680 Methane metabolism
    MmarC6_1168
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC6_1168
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC6_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_4 Fer4_13 Fer4_8 CH_2
Motif
Other DBs
NCBI-ProteinID: ABX01981
UniProt: A9A9F8
Position
1096103..1096360
Genome map
AA seq 85 aa AA seqDB search
MVNTGTIIYEPGSSANNKTGSWRVFKPVLDQDKCVKCENCYIFCPEGCIQEKDGKFEIDY
DYCKGCRICEKECPVKAIKTEREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacacaggaacgattatttatgaacctggaagttcagcaaataataaaactgga
agctggagagtattcaaaccagttttagaccaagacaaatgtgtaaaatgtgaaaactgt
tacattttctgtcctgaaggctgcatacaagaaaaagacggaaaattcgaaatcgattac
gattactgtaaaggatgtcgtatttgcgagaaagaatgccctgtaaaagcgataaaaaca
gaaagggaagaaaaataa

DBGET integrated database retrieval system