KEGG   Methanococcus maripaludis C6: MmarC6_1170Help
Entry
MmarC6_1170       CDS       T00615                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00010  Glycolysis / Gluconeogenesis
mmx00020  Citrate cycle (TCA cycle)
mmx00620  Pyruvate metabolism
mmx00633  Nitrotoluene degradation
mmx00640  Propanoate metabolism
mmx00650  Butanoate metabolism
mmx00680  Methane metabolism
mmx00720  Carbon fixation pathways in prokaryotes
mmx01100  Metabolic pathways
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
Module
mmx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmx_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_1170
   00020 Citrate cycle (TCA cycle)
    MmarC6_1170
   00620 Pyruvate metabolism
    MmarC6_1170
   00640 Propanoate metabolism
    MmarC6_1170
   00650 Butanoate metabolism
    MmarC6_1170
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC6_1170
   00680 Methane metabolism
    MmarC6_1170
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC6_1170
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC6_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABX01983
UniProt: A9A9G0
Position
1097562..1098458
Genome map
AA seq 298 aa AA seqDB search
MTGSQFPREELFAPGHRGCAGCGAAIVARLALKAAGKNTIVANATGCLEVMTTPYPETAW
RVPWVHVAFENAAAVASGIEGAVTALKRKKGKYGEEKVNVIAFGGDGGTADIGFQALSGA
MERGHDMVYIMYDNEAYMNTGVQRSGSTPFMASTTTSPAGSHIRGENRPKKDMPMIMAAH
GIPYIATASISYPEDFMNKVKKACEINGPAFIQVLQPCTTGWGYPAENTIEMGRLAVETG
VWPLFEIENGEFKLNYKPLKRKPIEEYLKVQKRYRHLKPEDISVIQKTIDMKCDEYGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactggaagccaatttccaagagaagaattatttgctccaggacacaggggctgtgca
ggatgtggtgcagcaattgtcgcaagactcgctttaaaagctgctggaaaaaatacaatc
gttgcaaatgctacaggatgtcttgaagttatgacaacaccctatcctgaaactgcgtgg
agagttccttgggttcacgttgcatttgaaaatgctgcagcagtagcaagcggtattgaa
ggagccgtaactgctttaaaaagaaagaagggaaaatacggtgaagaaaaagtaaacgtc
attgcatttggtggtgatggcggtactgcagatatcgggttccaagcactcagtggtgca
atggaaagaggacatgatatggtgtacatcatgtacgataacgaagcttacatgaacact
ggagttcaaagaagtggttcaacacctttcatggcgtcaacaacaacttcgcctgctgga
agccatatccgtggagaaaaccggcctaaaaaagacatgccaatgatcatggcagctcat
ggaattccttacattgcaacagcatcaataagctacccggaagacttcatgaacaaagtt
aaaaaagcatgtgaaataaacggtcctgcatttatccaggtacttcagccatgtactacc
ggctggggataccctgccgaaaatacaattgagatgggtagacttgcagttgaaactggt
gtttggccacttttcgaaattgaaaatggcgaatttaagttaaactacaagccactgaaa
agaaaaccaattgaagaatacttaaaagtgcagaaaagatacagacacttaaaacccgaa
gatatttcagtaattcaaaagaccatcgacatgaaatgcgacgaatacggtctttaa

DBGET integrated database retrieval system