KEGG   Methanococcus maripaludis C6: MmarC6_1170Help
Entry
MmarC6_1170       CDS       T00615                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC6_1170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_1170
   00020 Citrate cycle (TCA cycle)
    MmarC6_1170
   00620 Pyruvate metabolism
    MmarC6_1170
   00640 Propanoate metabolism
    MmarC6_1170
   00650 Butanoate metabolism
    MmarC6_1170
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC6_1170
   00680 Methane metabolism
    MmarC6_1170
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC6_1170
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC6_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1097562..1098458
Genome map
AA seq 298 aa AA seqDB search
MTGSQFPREELFAPGHRGCAGCGAAIVARLALKAAGKNTIVANATGCLEVMTTPYPETAW
RVPWVHVAFENAAAVASGIEGAVTALKRKKGKYGEEKVNVIAFGGDGGTADIGFQALSGA
MERGHDMVYIMYDNEAYMNTGVQRSGSTPFMASTTTSPAGSHIRGENRPKKDMPMIMAAH
GIPYIATASISYPEDFMNKVKKACEINGPAFIQVLQPCTTGWGYPAENTIEMGRLAVETG
VWPLFEIENGEFKLNYKPLKRKPIEEYLKVQKRYRHLKPEDISVIQKTIDMKCDEYGL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactggaagccaatttccaagagaagaattatttgctccaggacacaggggctgtgca
ggatgtggtgcagcaattgtcgcaagactcgctttaaaagctgctggaaaaaatacaatc
gttgcaaatgctacaggatgtcttgaagttatgacaacaccctatcctgaaactgcgtgg
agagttccttgggttcacgttgcatttgaaaatgctgcagcagtagcaagcggtattgaa
ggagccgtaactgctttaaaaagaaagaagggaaaatacggtgaagaaaaagtaaacgtc
attgcatttggtggtgatggcggtactgcagatatcgggttccaagcactcagtggtgca
atggaaagaggacatgatatggtgtacatcatgtacgataacgaagcttacatgaacact
ggagttcaaagaagtggttcaacacctttcatggcgtcaacaacaacttcgcctgctgga
agccatatccgtggagaaaaccggcctaaaaaagacatgccaatgatcatggcagctcat
ggaattccttacattgcaacagcatcaataagctacccggaagacttcatgaacaaagtt
aaaaaagcatgtgaaataaacggtcctgcatttatccaggtacttcagccatgtactacc
ggctggggataccctgccgaaaatacaattgagatgggtagacttgcagttgaaactggt
gtttggccacttttcgaaattgaaaatggcgaatttaagttaaactacaagccactgaaa
agaaaaccaattgaagaatacttaaaagtgcagaaaagatacagacacttaaaacccgaa
gatatttcagtaattcaaaagaccatcgacatgaaatgcgacgaatacggtctttaa

DBGET integrated database retrieval system