KEGG   Methanococcus maripaludis C6: MmarC6_1399Help
Entry
MmarC6_1399       CDS       T00615                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC6_1399
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_1399
   00620 Pyruvate metabolism
    MmarC6_1399
   00640 Propanoate metabolism
    MmarC6_1399
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC6_1399
   00680 Methane metabolism
    MmarC6_1399
Enzymes [BR:mmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MmarC6_1399
Lipid biosynthesis proteins [BR:mmx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MmarC6_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1302098..1303777
Genome map
AA seq 559 aa AA seqDB search
MVSLVNNYVKKTDFESYEDFVENFKIDVPENFNFAYDIVDEYAKIAPEKIAIIWCDDNND
EKIFTFKDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFCMLGLHKIGAVAIPATH
MLTTKDIVYRIEKAGLKMIVCIGENGVPEYVDEAVSEINSDVLKACVLNLNNESWIDFSK
ELEESSDDFTRPVGEKDTKNEDVLVAYFSSGTTGYPKLIQHDHEYPLGHITTAKYWQNVE
DDGLHYTVADSGWAKCIWGKLYGQWISGTAVFVYDYDRFDAGNMLEKIAKYKITTFCAPP
TIYRFMIKQDISKADFSSLHYAVTAGEPLNPEVYNKFLEFTGLRLMEGFGQTETVVSVAN
FPWMDPKPGSMGKPVPIFDLMIKGPDGNECDVGEEGELVFKTKDGKPLGLFSGYFKDPER
TKKSWYDGYYHTGDTAWKDEDGFLWFVGRNDDLIKSSGYRIGPFEVESALISHPAVLECA
ITGVPDPVRGQIVKATIVLTGDYEASEELKKELQDHVKHNTAPYKYPRAIDFVKELPKTI
SGKIRRVEIREKDEEKSNN
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggtatctttagttaataattatgttaaaaaaacggactttgagtcatacgaagacttt
gtggaaaattttaagatagacgttcctgaaaacttcaactttgcttacgatatcgttgac
gaatacgcaaaaattgcacccgaaaagattgcaatcatatggtgcgatgacaataacgac
gaaaaaatctttacattcaaagatatgaaaaaatacagtgataaagcagctaatttcttt
ttaaaacacggaattaaaaagggagatactgtaatgctcacattaaagagcaggtatgaa
ttctggttctgcatgcttggactccataaaattggagctgttgcaattcctgcaacacat
atgcttacaacaaaagatattgtttaccgaatcgaaaaagcaggcttaaaaatgatagtc
tgcatcggtgaaaacggagttccagaatacgttgatgaagcagtatctgaaattaattca
gatgttttaaaagcatgtgttttaaatttaaacaatgaatcttggattgatttttcaaaa
gaattggaagaatcatcagatgattttacaaggcctgttggagaaaaggatactaaaaat
gaagatgtattggttgcatacttttcatctggaacaacgggatatccaaaattaattcag
cacgaccatgaatatcctttaggacacattacaactgcaaaatactggcaaaacgttgaa
gacgatggacttcactacacagttgcagacagcggctgggcaaagtgtatctggggaaaa
ctctacggccagtggatttccggaactgcagtatttgtctatgactacgatagatttgat
gcaggaaacatgcttgaaaaaattgcaaaatataaaattacaacgttttgtgcaccacct
acaatttacaggttcatgataaagcaggatatctcaaaagcagacttttcaagtcttcat
tatgcagtaactgctggagaacccctaaaccctgaagtttacaacaagtttttggagttt
acaggtcttagattaatggaaggatttgggcagacagaaacagttgtttcagttgcaaat
ttcccgtggatggatccaaaacctggatcaatgggaaaacctgtaccaatctttgatttg
atgataaagggaccggatggaaacgaatgtgatgttggtgaagaaggagaacttgtattt
aaaacaaaagacggaaaaccactcggtcttttctcaggatactttaaagaccctgaaaga
accaaaaaatcatggtacgatggatactaccatactggtgacactgcatggaaagatgaa
gatggattcctctggtttgttggacgaaatgatgatttaattaaaagttcgggataccga
attggtcctttcgaagtcgaaagtgcacttatttcacaccctgcggtgcttgaatgtgca
ataactggggttcctgatcctgtacggggccagatagttaaagctacaattgttttaacc
ggagattatgaagcaagcgaagaactcaaaaaagaacttcaagaccacgttaaacacaac
acagccccatacaaatatccgagggcaattgactttgtaaaagaactcccaaaaacaatc
agtgggaaaattaggcgtgtggaaatccgagaaaaggatgaagaaaaaagtaataattaa

DBGET integrated database retrieval system