KEGG   Methanococcus maripaludis C6: MmarC6_1415Help
Entry
MmarC6_1415       CDS       T00615                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1320678..1321646
Genome map
AA seq 322 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETVLTKNDLVMPIFVDENLEDNEKTQILSMPGQFRYGIDAA
VNECVEISELGVPAVILFGIPAEKDEFATSAINEQGGVQKVISKVKAKLGDDLLVIADVC
MCEYTSHGHCGIISGEEILNDETLEVLGNIALSYAKAGVDIVAPSDMMDGRVLKIRNFLD
ENGFKNVSIMSYAAKYASAFYGPFRDAAESTPQFGDRKSYQMDIGNSKEALKEIELDINE
GADLILVKPALPYLDIVKLAKEISNIPVGGYCVSGEYSMIEAAAQNGWIDREKAIFETLL
GIKRAGADFIISYWAKEVANWL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaggccaagaagacttaggaaaaaccagaaaatccgggatttagtaagagaa
acagttttaacgaaaaatgatctagtaatgccaattttcgtagatgaaaatttagaagac
aatgaaaaaacccagattctatcaatgcctggccagttccgatatgggatagatgcagca
gtcaatgaatgtgttgaaatttcagaattgggggttccagcagtaattttgtttggaatt
ccggctgaaaaggacgaatttgcaacttctgcgataaatgaacagggtggcgttcaaaag
gttatttcaaaagtaaaagctaaacttggggatgatcttttggtaattgcagatgtctgc
atgtgtgaatatactagccatggtcactgcggtataatatctggggaagaaattttaaac
gatgaaactcttgaagtgcttggaaacattgctttatcgtatgcaaaagcaggcgttgat
attgttgcgccatctgacatgatggatggaagagttttaaaaattagaaattttctggat
gaaaacggatttaaaaacgtttcaataatgagctatgctgcaaaatatgcatctgcattt
tatgggccatttagagatgctgcagaaagcacacctcaatttggggatagaaaatcttac
caaatggatattggaaactcaaaagaggctttaaaagagatagaactcgatataaacgaa
ggtgcagatttaattttggtaaaacctgctcttccgtatctcgatattgtaaaattggca
aaagagatatccaacattccagttgggggttactgcgtgagtggggaatattcaatgatt
gaagcagcagctcaaaatggatggatcgatcgggaaaaagcaatattcgaaaccctattg
ggtataaaaagggcaggtgctgattttataatatcctactgggcaaaagaagtggccaat
tggctctaa

DBGET integrated database retrieval system