KEGG   Methanococcus maripaludis C6: MmarC6_1429Help
Entry
MmarC6_1429       CDS       T00615                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mmx  Methanococcus maripaludis C6
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC6_1429
  Energy metabolism
   00680 Methane metabolism
    MmarC6_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1333189..1333635)
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAVVAINMRKEGKLQREIAEFLEMDRSIISHYLHGRYPSDKVMRVSEEIIN
LPREYGIPLITSLGDNKQITKKLIERIYNIKINIDMEKCIACGKCLECEYGAISVYSEDI
GISIDREKCILCCKCVSECPVGALKIVK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatattctatcagggatcaaagcagtagtcgcaataaatatgcgaaaagaa
gggaaacttcaaagagagatagcagagtttctagaaatggatcgttcaatcatctcccac
tacctacacggcagatatccatcagataaggtcatgagagtctctgaagagattataaat
ttaccccgagaatacggtattccactaattacttcgcttggtgacaacaagcagattact
aaaaagttaatagaacggatttataatataaaaataaatattgacatggaaaagtgtatt
gcatgtggcaaatgccttgaatgcgaatacggggcaatttcagtatattccgaagatatc
ggtatatcgatagacagagaaaaatgcattctttgttgtaaatgcgtttccgaatgtcct
gttggtgctttgaaaatagtcaaataa

DBGET integrated database retrieval system