KEGG   Methanococcus maripaludis C6: MmarC6_1551Help
Entry
MmarC6_1551       CDS       T00615                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mmx00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1450286..1451338)
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDNVREYMEKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKFIDDKGFLKFTKIGGINDQMLLNQKVIVHSNEGDIVGVLGSKPPHKMKE
SERNKLISAEHMFIDIGAKNKEDAEKMGVEIGTAISFKSEFDNLGGNVVSCKSFDNRAGC
AVVLKTMELIKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLRMVRDVAKADEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacactcgattatttaaagattctcgcaacagaaaaagggatttctggaagagaa
gataatgtaagagaatacatggaaaaagaacttgaaaaatactgtgacagtattgaaaca
gacaaatttggaaatttaattgcaaaaaaaggatcaaccggtccaaaaattatgattgca
tcacacatggatgaaatcgggcttatggttaagttcatcgatgataaaggatttttaaaa
tttacaaaaattggcggaattaacgaccagatgcttttaaaccagaaagttatcgttcac
agtaatgaaggtgatattgttggtgttttgggatcaaaaccaccccataaaatgaaagaa
agcgaacgaaacaagttaatttctgctgaacacatgtttatcgacatcggtgcaaaaaat
aaagaagatgcagaaaaaatgggtgttgaaataggtactgcaatttcattcaagtctgaa
ttcgacaacctcggtggaaatgtagtttcatgtaaatcatttgacaacagggcaggctgt
gcagttgttttgaaaaccatggaattaatcaaagatatggatttaaaatgccaggtttac
gctgttggaacagttcaggaagaagttggattgaaaggtgcaaaaacgtctgcatttgga
attaatcctgatgttgcattcgcacttgacgttacaatctgtggagaccaccccggaatt
aaattagaggatgcaccggtagaacttggaaaaggtcctgttgcaacaattgttgatgct
tcaggaaggggaattatcacccacccaacagttttaagaatggttagagatgttgcaaaa
gcagatgaaattcctgtccaatatgaagttggagaaggaggaactactgatgcaactgca
atccacttaacaagagatggaattccaacaggagttatatccgttccttcaagatacatc
cacacaccagttgaagttattgatacagaagaccttgaaaaaacaaccgaactcgttgtt
gcgtgcattaaaaaagtacacgaatacttttaa

DBGET integrated database retrieval system