KEGG   Methanococcus maripaludis C6: MmarC6_1562Help
Entry
MmarC6_1562       CDS       T00615                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00020  Citrate cycle (TCA cycle)
mmx00640  Propanoate metabolism
mmx00660  C5-Branched dibasic acid metabolism
mmx00720  Carbon fixation pathways in prokaryotes
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
Module
mmx_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MmarC6_1562
   00640 Propanoate metabolism
    MmarC6_1562
   00660 C5-Branched dibasic acid metabolism
    MmarC6_1562
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC6_1562
Enzymes [BR:mmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MmarC6_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 DUF5461 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABX02374
UniProt: A9AAK1
Position
complement(1459937..1461025)
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENGIPIPKNKLTCGKVDSIDYPVVIKAQVLVGGRGKAGGILFADNLD
DANEKIESLIGKTVKGELVEKVLLEEQIKIAKEYYVGVVVSRNEKNNVVIFSTEGGVDIE
EVASKTPKKIIKLQLEPGKEFLPYLAREMLKKAGIPSAEIPKVADVLCKVYKAFKDMDGI
LAEINPLVFTEDGKIIAADAVLNIDDDAYFRHKYDKFEEFNKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGNPACFLDVGGGSNRETVKKALLKATSRKNVKGAFINILGGI
TRCDEVSLGIVDVLKENPNLKFAVRMMGTNEEEGRKILSENGVNFENSMEGAAKALMELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatgaagcaaaggaaatttttaaagaaaatggaatcccaattcca
aaaaataaacttacttgcggtaaagttgatagtatcgattatcctgttgtcataaaagcg
caagttttggtcggtggaaggggaaaagctggcggaatcttatttgcagataatttagat
gatgcaaacgaaaaaattgaatcattaattggaaaaacggtaaagggagaactcgttgaa
aaagtactccttgaagagcagattaaaatcgcgaaagaatactatgttggcgttgttgtt
agcagaaacgaaaaaaacaatgttgtcatattttcaaccgaaggtggagtggatattgaa
gaagtagcctcaaaaactcctaaaaaaataataaaattacaattagaacctggaaaagaa
tttttaccctaccttgcaagagaaatgctcaaaaaagcaggcattccaagtgcagaaatt
ccaaaagtagcagatgttttatgcaaagtttacaaagcattcaaagacatggatggaatt
ttagcagaaataaacccgttagtgtttaccgaagatggaaaaatcattgctgctgatgcg
gttttaaatattgacgacgatgcatatttcagacataaatacgataaatttgaagaattt
aacaaacaggaaaaatccgaatttgcatacgttgaacttgatggagacattgcagttatt
ggaaatggtgcagggctaactcttgcaagcatggatattgtaaaagagttcggtggaaat
cctgcatgtttcttagatgttggtggcggttcaaatagggaaaccgtaaaaaaagcactt
ttaaaagcaacttctagaaaaaatgttaaaggagcatttatcaacattcttggtggaatc
acaagatgtgatgaagtttcacttggaattgtagacgttttaaaagaaaatccaaacctc
aagtttgccgttagaatgatgggaactaacgaagaagaaggaagaaaaatcctttctgaa
aatggagtaaacttcgaaaattcaatggaaggggctgcgaaagcacttatggaattaata
aacagttaa

DBGET integrated database retrieval system