KEGG   Methanococcus maripaludis C6: MmarC6_1657Help
Entry
MmarC6_1657       CDS       T00615                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00260  Glycine, serine and threonine metabolism
mmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01130  Biosynthesis of antibiotics
mmx01230  Biosynthesis of amino acids
Module
mmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MmarC6_1657
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC6_1657
Enzymes [BR:mmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MmarC6_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth FMN_dh PA PcrB NanE TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ABX02469
UniProt: A9AAU6
Position
1558111..1558887
Genome map
AA seq 258 aa AA seqDB search
MNKPVLVSFLVSGDPNPDATLKFMKTLDKYSGVIELGIPFSDPVADGPTIQAADVRALSN
GFKIAKSFEVLKEFRKESNTPVILMTYYNPVYKRGIENFVISAKEAGANGLVIVDLPLQE
ATEYREICKKHEMGTVFLAAPNTPEDRLKTSDEASTEFLYLISTFGITGARESFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSEEALVKLE
ELAKELSEGIEKGYEKRK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccagtgttagtcagttttttagtttctggtgatccaaatccggatgcaaca
ttgaaatttatgaaaacactcgataaatattcgggagtaatcgagcttggaattccattc
agcgatcctgttgcagacgggccaacaattcaggcagcagatgtaagggcactttcaaac
ggatttaaaattgcaaaatcattcgaagtattgaaagaatttagaaaagagtccaatacc
cccgtaattttgatgacatactacaatccggtttacaaaagagggattgaaaacttcgta
attagtgcgaaagaagcaggtgcaaatggacttgttatcgttgatttgccacttcaagaa
gcaacagaatatcgagaaatctgtaaaaaacacgaaatgggaacagtatttcttgcagca
ccaaatactcccgaagataggttaaaaacatcagatgaagcaagtactgaatttttgtac
cttatttcaacattcggaataaccggtgcaagagaatcatttgaacagatgacgtttgat
tttatcaaaagggcaaggacaacttgcaaaggaaaaatctgtgttggatttggaatttca
aaaggaagccacgcagaaagtttaatagaacagggtgcagacggcgtaatcgttggaagt
gcttttgtagatattattaaaaattatggggattcagaagaagcacttgttaaattagaa
gaactcgcaaaagaattaagcgaaggaatcgaaaaaggatacgaaaaaagaaaataa

DBGET integrated database retrieval system