KEGG   Methanococcus maripaludis C6: MmarC6_1687Help
Entry
MmarC6_1687       CDS       T00615                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00340  Histidine metabolism
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MmarC6_1687
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MmarC6_1687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF2884
Motif
Other DBs
NCBI-ProteinID: ABX02499
UniProt: A9AAX6
Position
complement(1586055..1587329)
Genome map
AA seq 424 aa AA seqDB search
MIVKKISELNEKDLDIILNRNKTNISGILPTVSEILENVQKNGDNALKEYTKKFDGVDID
NFKVTSEEIDKAYEKIDSKVVESLEKAYMNIKEFHEIQFKNLTEWEVEKEGIKAGQIIRS
VEKAGCYVPGGRAFYPSTVLMTVTPAKVVGVKKVVVTSPPNGTEGNPATLVASDIAKADE
IYKIGGAQAIGALAYGTESIPKVDIIVGPGNIFVTAAKKLVYGEVSIDFPAGPSEVLIMC
DESSNEEYVAMDFLAQAEHDPNASCVITVTSEEKAEQIKERILMEIKTAKRTEIIEKSIL
NSAIVTGSLEDCIELSNNYAPEHLEIMTKNPREVLNSIENAGSIFLGNYAPVPVGDYASG
TNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLNKIGNIVTTLAEAEGLFNHSEAVK
RRLN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatagtcaaaaaaatatccgaattaaacgaaaaagacctagatattatacttaacagg
aataaaacaaatatctcagggattttaccaactgtaagcgaaattttagaaaatgtccaa
aaaaatggggataatgcattaaaagaatacactaaaaaatttgacggtgtggacattgat
aatttcaaggtaacttccgaagaaatcgataaagcatatgaaaaaatcgattcaaaagta
gttgaatcccttgaaaaagcttacatgaatattaaagaatttcacgaaattcaatttaaa
aatttaactgaatgggaagttgaaaaggaaggaattaaagcagggcagatcatcagatct
gttgaaaaggctggatgctatgttccaggcggaagagcattttatccatctaccgtttta
atgactgtaacccctgcaaaagttgtaggtgtcaaaaaagttgttgtaacttcccctcca
aatggaactgaagggaatcctgcaacgcttgttgcttcagacattgcaaaagctgacgaa
atatacaaaattggtggtgcacaggcaatcggagctcttgcatacggcacagaatctatt
ccaaaagttgatattatcgttggacctggaaatatctttgtaactgcagctaaaaagtta
gtttacggggaagtttcaattgattttccagcaggcccttcagaagttcttattatgtgt
gatgagtcttcgaatgaagaatacgttgcaatggactttttggctcaagctgaacacgac
ccgaacgcatcatgtgtaataactgttacatcagaagaaaaagcagaacaaattaaagaa
agaattttaatggaaataaaaactgctaaaagaacggaaattattgaaaagtcaatttta
aattctgcaattgttaccggttcacttgaagattgcattgaactttcaaacaattacgcc
ccagaacatctagaaataatgacgaaaaatccgagggaagtgttaaactcaattgaaaat
gctggaagtatctttttaggaaactatgcgccggttccggttggagattatgcaagcggt
acaaaccacgttcttccaacatcagcttgtgcaaaaatgtattctggcctcagtgttgaa
acctttatcaaaaagccaacagttcaggaattaacaaaagaaggcctaaataaaattgga
aatattgtaactacgcttgcagaagcagaagggttatttaaccactctgaagccgttaaa
agaaggttaaattaa

DBGET integrated database retrieval system