KEGG   Methanococcus maripaludis C6: MmarC6_1737Help
Entry
MmarC6_1737       CDS       T00615                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mmx  Methanococcus maripaludis C6
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MmarC6_1737
Enzymes [BR:mmx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MmarC6_1737
Peptidases [BR:mmx01002]
 Cysteine Peptidases
  Family C44
   MmarC6_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1633399..1634940
Genome map
AA seq 513 aa AA seqDB search
MCSISGIVAKDEEGSGSRSLLDNIQKHVINMMKILKHRGPDYSGMMFDDEVLYFENFDDV
VENTETISRMAMGHNRLAIVGTAVQPIPNDDESIWIICNGEIYNHIELRDELSVEHEFKT
DTDSEAIIHAYEDELIDVLDGDYAYAIYDKEKNIIELRRDLIGVKPLYFIDTDEYFAFAS
EKKALHYLLMEINCLDYKSAFNYDISRLNPNSRLTFELDENSWYIEEELEKVNSNYFEEN
DYELCKNELETTILDSVLKRVNGLEKVGIIYSGGVDSTLISKLASESCEVILYSVGSENS
EDLIYAERAAKDMGLNFRKKIISEDEFEEYVVKVARAIDELDVMKISVGIPILAASEMAR
EDGIKVVLSGQGADELFAGYNRYQRILKEKGEDGLKNSIISDVFDIHKINLERDDHCTMA
NGVELRVPFLDKFVIDVGLSIPVEYKIEEPRKKILRDIASKYVPDYIAQRPKKAAQYGSG
SEKMVYAVAKKHGYSKKEINKFFEEYLLEKIKF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaataagtggaatagttgcaaaagacgaagagggctcggggagtcgtagtctg
ttggataatatccaaaaacatgttataaacatgatgaaaatattaaagcatcggggtccg
gattattctggaatgatgtttgatgatgaagttctctattttgaaaattttgatgatgtt
gttgaaaacaccgaaacaatttcgcgaatggcaatgggccacaacaggcttgctatcgtt
ggtactgcagttcaaccaatacctaacgacgatgaatccatatggattatctgcaatggt
gaaatctataatcacattgaattaagggacgaactgtcagtagaacatgagtttaaaaca
gatacggattctgaagcaattattcacgcttatgaagacgaacttatcgatgttttagat
ggggattacgcttacgcaatttacgataaagaaaaaaatatcattgaactaagaagagat
ttaattggtgtaaaaccactctattttatagacacggatgaatattttgcattcgcatcc
gaaaaaaaggctcttcactatttattaatggaaatcaattgtttggactacaaaagtgct
tttaattatgatatatcaagacttaatccaaattcaagacttacatttgaattagatgaa
aattcatggtacattgaagaagaacttgaaaaagtaaattcaaattattttgaagaaaat
gactatgaattgtgcaaaaatgaacttgaaactacaattttagattcagttttgaaacga
gtaaacgggcttgaaaaggtcggaattatatattcaggtggtgttgacagcacccttatt
tcaaaacttgcatctgaatcttgtgaagttatactttattcagtaggttcggaaaattct
gaagatttaatctatgcggaaagagctgcaaaagatatgggacttaactttagaaaaaaa
ataatttcagaagatgaatttgaagaatacgtagtaaaagttgcaagagcaatagatgaa
ctcgatgtaatgaagataagtgttggaattccgatacttgcagcttctgaaatggcaaga
gaagacgggataaaagttgtactttcaggtcaaggtgcagatgaactatttgcgggatac
aatagatatcagaggatattgaaagaaaaaggagaagacggccttaaaaactcaataatt
tcagatgtttttgatatccataagatcaatcttgaaagggatgaccactgtacaatggca
aacggtgttgaattaagagttccgtttttagataagtttgtaattgatgttggactttca
attccagttgaatataaaattgaagaaccaagaaaaaaaatattaagagatattgcttca
aaatatgttccggattatattgcacaaaggccaaaaaaagcggcccaatacggtagtgga
agcgaaaaaatggtctatgctgttgcaaaaaaacacggatattctaaaaaagaaataaat
aaattttttgaagaatatttacttgaaaaaataaaattttaa

DBGET integrated database retrieval system