KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0047Help
Entry
MSC_0047          CDS       T00161                                 

Gene name
recR
Definition
DNA repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSC_0047 (recR)
DNA repair and recombination proteins [BR:mmy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MSC_0047 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(56990..57358)
Genome map
AA seq 122 aa AA seqDB search
MIKMLETTFDEIIESIRTNQGLTKKTSERLLVDLLINKDKLNQFIDQLNKTKQLISTCKI
CGYLSENDKCLVCSLENRNQNIICIVSTILDAKNIENANKYKGVYHILNGEINLNKTLHL
IS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaatgttagaaactacatttgatgaaattattgaatcaattagaacaaatcaa
ggtttaactaaaaaaacatcagaaagattattagttgatttattaataaataaagataaa
ctaaatcaatttattgatcaattaaataaaacaaaacaattaatttcaacttgcaaaata
tgtgggtatttaagtgaaaatgataaatgtttagtatgtagtttagagaatagaaatcaa
aatataatttgtatagtttcaacaattttagatgcaaaaaacattgaaaatgctaataaa
tacaaaggggtttatcatattttaaatggcgaaattaatctaaataaaacattacatttg
ataagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system