KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0218Help
Entry
MSC_0218          CDS       T00161                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00230  Purine metabolism
mmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MSC_0218 (gmk)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MSC_0218 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 DUF1951 RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-GeneID: 2744659
NCBI-ProteinID: NP_975219
UniProt: Q6MU25
Position
complement(251730..252623)
Genome map
AA seq 297 aa AA seqDB search
MKKGKMIIISGPSGVGKGSVNGELLQNPDLHLRYSVSMTTRKPRNGEVDGVNYFFVSNEE
FAKAIVNDELIEYAHFVGNSYGTPRKYVEQELKKGNNVILEIEVDGATQVLNKEPNVLSI
FLMPPNPTELANRIRGRQTEDEEKIKARLDKALLEIPLKHNYQYVIENDNVPNAVAKITD
VLHLEGLTDIKTPTVYERLEQIVEQIVKEKYMYFVNNWETNVKLLAKNEEEKNKAKNFDA
ETYLIKLLTKKVYHKVLGHGDFSKLLDKDFVDFKIQKLMFKINFFSVEQKHYNNDEF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtaaaatgatcataatttcaggaccaagtggagttggtaaaggttcagtc
aatggagaacttttacaaaatccagatctacacttaagatattcagtttcaatgacaaca
agaaaacctagaaatggtgaagttgatggagtaaattatttttttgtttcaaatgaagaa
tttgcaaaagccattgttaatgatgagttaattgaatatgcacattttgttggtaattct
tatggtactcctagaaaatatgttgaacaagaattaaagaagggtaataatgttatttta
gaaattgaagtagatggagctactcaagttttaaataaagagccaaatgttttgtctatt
tttttaatgcctccaaatccaactgagctagctaatagaattagaggaagacaaactgaa
gatgaagaaaaaataaaagcacgattagataaagctttattagaaattcctttaaaacat
aattatcaatatgtaattgaaaatgataatgtacctaacgctgttgcaaaaattactgat
gttttacatttagaaggtttaactgatataaaaactccaactgtatatgaaagattagaa
caaattgttgaacaaattgttaaagaaaaatatatgtattttgttaataattgagaaact
aatgttaagttattagcaaaaaatgaagaagaaaaaaataaagctaaaaactttgatgct
gaaacttatttaattaaattattaactaaaaaggtatatcacaaagttctaggacatggt
gatttttctaaattactagataaagattttgttgattttaaaattcaaaaattaatgttt
aaaattaatttctttagtgttgaacaaaaacattataataacgatgaattctag

DBGET integrated database retrieval system