KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0260Help
Entry
MSC_0260          CDS       T00161                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSC_0260 (pfk)
   01230 Biosynthesis of amino acids
    MSC_0260 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSC_0260 (pfk)
   00030 Pentose phosphate pathway
    MSC_0260 (pfk)
   00051 Fructose and mannose metabolism
    MSC_0260 (pfk)
   00052 Galactose metabolism
    MSC_0260 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MSC_0260 (pfk)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSC_0260 (pfk)
Protein phosphatases and associated proteins [BR:mmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MSC_0260 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295427..296518
Genome map
AA seq 363 aa AA seqDB search
MAICKIGSKYTFTIRGILFCYIIKFMLMCFLERGLYLMIKKIGILTSGGDAPGMNNAIAG
VVKTAASKGIEVYGINDGYKGLVNGWFEKLNVEKTLDILSRGGTYLGSARLPEFKELEVR
QKAVANLKKAGIEALVVIGGDGSYMGAQKLTEMGINCIGLPGTIDNDISSTDYTIGFHTA
LNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTYTAVATGAEIFSPAEDLLTIEQMG
QKAKQFRLLGKKSLIILVSEKSYGISAKEIAEKIQKISGYETKATVLGHIQRGGRPTAMD
RYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDIDSTLNMKKEDKKPFIKYLREINGY
FSK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatctgtaaaataggttcaaagtatacctttacaattaggggtatacttttttgt
tatataattaaatttatgttaatgtgttttttagaaagaggtttatatttaatgataaaa
aaaattggaattttgacttctggaggggatgctcctggaatgaataatgccattgctgga
gttgtaaaaacagcagcttcaaaaggaattgaagtatatgggattaatgatgggtataaa
ggattagttaatggttgatttgaaaaactaaatgttgaaaaaactttagatattctttca
agaggtggaacttatttaggatctgcaagattaccagaatttaaagaattagaagtaaga
caaaaagctgttgctaatttaaaaaaagctggaattgaagctttagttgtaattggtgga
gatggtagttatatgggtgctcaaaaattaactgaaatgggtattaattgtattggatta
cctggaactattgataatgatatttcttcaactgattatactattggttttcatactgca
ttaaacacaattgttgaagcagttgatagaattagagatacaatgcaatcacacaataga
gcagacgttgttgaaattatgggaaatggttgtggtgatttagtaacttatactgcagtt
gctacaggagctgaaattttttcaccagctgaagatctactaacaattgaacaaatgggt
caaaaagcaaaacaatttagattattaggtaaaaaaagtttaattattttagtttcagaa
aaatcatatggaatttcagctaaagaaattgctgaaaaaattcaaaaaattagtggttat
gaaactaaggcaactgttttaggacatattcaacgtggtggtagaccaactgctatggat
agatatattgcttttacagcaggtatgtttgctgttgaaaaattagctgaaggtaaaggt
ggattatttatcgggttagaaaataataaattagttgcaagagatattgattcaacttta
aatatgaaaaaagaagataaaaaaccatttattaaatatttaagagaaattaatggatat
tttagtaaataa

DBGET integrated database retrieval system