KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0260Help
Entry
MSC_0260          CDS       T00161                                 

Gene name
pfk
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00010  Glycolysis / Gluconeogenesis
mmy00030  Pentose phosphate pathway
mmy00051  Fructose and mannose metabolism
mmy00052  Galactose metabolism
mmy00680  Methane metabolism
mmy01100  Metabolic pathways
mmy01110  Biosynthesis of secondary metabolites
mmy01120  Microbial metabolism in diverse environments
mmy01130  Biosynthesis of antibiotics
mmy01200  Carbon metabolism
mmy01230  Biosynthesis of amino acids
mmy03018  RNA degradation
Module
mmy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSC_0260 (pfk)
   00030 Pentose phosphate pathway
    MSC_0260 (pfk)
   00051 Fructose and mannose metabolism
    MSC_0260 (pfk)
   00052 Galactose metabolism
    MSC_0260 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MSC_0260 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MSC_0260 (pfk)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSC_0260 (pfk)
Protein phosphatases and associated proteins [BR:mmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MSC_0260 (pfk)
Messenger RNA biogenesis [BR:mmy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MSC_0260 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK HTH_12 NAD_kinase
Motif
Other DBs
NCBI-GeneID: 2744269
NCBI-ProteinID: NP_975259
UniProt: Q6MTY5
Position
295427..296518
Genome map
AA seq 363 aa AA seqDB search
MAICKIGSKYTFTIRGILFCYIIKFMLMCFLERGLYLMIKKIGILTSGGDAPGMNNAIAG
VVKTAASKGIEVYGINDGYKGLVNGWFEKLNVEKTLDILSRGGTYLGSARLPEFKELEVR
QKAVANLKKAGIEALVVIGGDGSYMGAQKLTEMGINCIGLPGTIDNDISSTDYTIGFHTA
LNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTYTAVATGAEIFSPAEDLLTIEQMG
QKAKQFRLLGKKSLIILVSEKSYGISAKEIAEKIQKISGYETKATVLGHIQRGGRPTAMD
RYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDIDSTLNMKKEDKKPFIKYLREINGY
FSK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatctgtaaaataggttcaaagtatacctttacaattaggggtatacttttttgt
tatataattaaatttatgttaatgtgttttttagaaagaggtttatatttaatgataaaa
aaaattggaattttgacttctggaggggatgctcctggaatgaataatgccattgctgga
gttgtaaaaacagcagcttcaaaaggaattgaagtatatgggattaatgatgggtataaa
ggattagttaatggttgatttgaaaaactaaatgttgaaaaaactttagatattctttca
agaggtggaacttatttaggatctgcaagattaccagaatttaaagaattagaagtaaga
caaaaagctgttgctaatttaaaaaaagctggaattgaagctttagttgtaattggtgga
gatggtagttatatgggtgctcaaaaattaactgaaatgggtattaattgtattggatta
cctggaactattgataatgatatttcttcaactgattatactattggttttcatactgca
ttaaacacaattgttgaagcagttgatagaattagagatacaatgcaatcacacaataga
gcagacgttgttgaaattatgggaaatggttgtggtgatttagtaacttatactgcagtt
gctacaggagctgaaattttttcaccagctgaagatctactaacaattgaacaaatgggt
caaaaagcaaaacaatttagattattaggtaaaaaaagtttaattattttagtttcagaa
aaatcatatggaatttcagctaaagaaattgctgaaaaaattcaaaaaattagtggttat
gaaactaaggcaactgttttaggacatattcaacgtggtggtagaccaactgctatggat
agatatattgcttttacagcaggtatgtttgctgttgaaaaattagctgaaggtaaaggt
ggattatttatcgggttagaaaataataaattagttgcaagagatattgattcaacttta
aatatgaaaaaagaagataaaaaaccatttattaaatatttaagagaaattaatggatat
tttagtaaataa

DBGET integrated database retrieval system